Result : P96728
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YwsA |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 3707836 |
| Right | 3708132 |
| Strand | + |
| Nucleotide Sequence | ATGGATCAATTTGAAGCAGCATATGAATCGTATAAAGCCCGGCAAACAACTGCCGATCAAGAAAATGTTCCATCTGGAAAAGAAGAAATTATTGCGGTTAGAAGAAATGAGGAAGACAATATTATCGCAGTGAAAACCAATACAGGAAGAGAGCTCGACTACCCTACTGCGCTGTCAGAAGCAAAATCAGGAAAACTCGCTCATGTTGATGTCTTCCATAAATACGGGCGTGACATTTTGCGAAGTGAACCGGACGGCATCAAGGAAAATAACCTGTCTGAGCTGCCGGATTTTTAA |
| Sequence | MDQFEAAYESYKARQTTADQENVPSGKEEIIAVRRNEEDNIIAVKTNTGRELDYPTALSEAKSGKLAHVDVFHKYGRDILRSEPDGIKENNLSELPDF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam13031. Profile Description: Protein of unknown function (DUF3892). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 87 and 104 amino acids in length. |
| Pubmed ID | 9384377 9353933 |
| Domain | CDD:404050 |
| Functional Category | Others |
| Uniprot ID | P96728 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 27
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3707836 | 3708132 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3517840 | 3518136 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 3579637 | 3579933 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 2540617 | 2540913 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 3573483 | 3573785 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 3528631 | 3528927 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 7 | 3497578 | 3497874 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 2936317 | 2936613 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 9 | 2118609 | 2118905 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 10 | 2339593 | 2339889 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 11 | 1779082 | 1779405 | - | NZ_LR134338.1 | Brevibacillus brevis |
| 12 | 2112581 | 2112826 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 13 | 2894241 | 2894507 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 14 | 1236594 | 1236905 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 15 | 3477892 | 3478152 | + | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 16 | 2995912 | 2996226 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 17 | 3878765 | 3879070 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 18 | 2897121 | 2897411 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 19 | 2349532 | 2349834 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 20 | 2937220 | 2937510 | - | NC_011725.1 | Bacillus cereus B4264 |
| 21 | 2282879 | 2283193 | + | NZ_CP040336.1 | Bacillus luti |
| 22 | 1027997 | 1028308 | + | NZ_LS483476.1 | Lederbergia lentus |
| 23 | 1592074 | 1592322 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 24 | 1998710 | 1998976 | - | NZ_CP026363.1 | Brevibacillus agri |
| 25 | 2823006 | 2823296 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 26 | 2393834 | 2394109 | + | NZ_CP053989.1 | Niallia circulans |
| 27 | 4549885 | 4550127 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
++ More..