Result : P96727
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YwqO |
| NCBI Accession ID | Z92952.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 13570 |
| Right | 13791 |
| Strand | + |
| Nucleotide Sequence | ATGAAGTTTTTGCTGTCGGTCATTGCTGGCTTGCTGATTCTTGCACTCTATTTATTTTGGAAGGTCCAGCCTCCTGTTTGGATACAAGTTGAAACCAATTCGTCCCAGTTGAAGCAATCTGTGAGAATGGCAGGAACCACGCTGCAAGTCAAGCACATGATCAAGAGTGACGCAGGAGAAGAAACAGCTGTCATATCAAACGGCATTTCTGGGCTAAAATAA |
| Sequence | MKFLLSVIAGLLILALYLFWKVQPPVWIQVETNSSQLKQSVRMAGTTLQVKHMIKSDAGEETAVISNGISGLK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9353933 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P96727 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3722568 | 3722789 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3543251 | 3543472 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 3528985 | 3529206 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 3590972 | 3591190 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 462464 | 462682 | + | NZ_CP011937.1 | Bacillus velezensis |
| 6 | 3582006 | 3582224 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 7 | 3584675 | 3584899 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 8 | 2521225 | 2521449 | + | NZ_CP029364.1 | Bacillus halotolerans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13789.8 | 0.88 | 7 | 3438 | opposite-strand | Domain of unknown function (DUF4181) |
| 2 | PF01019.23 | 1.0 | 8 | 1856.5 | same-strand | Gamma-glutamyltranspeptidase |
| 3 | PF13404.8 | 1.0 | 8 | 1166.5 | opposite-strand | AsnC-type helix-turn-helix domain |
| 4 | PF13412.8 | 1.0 | 8 | 1166.5 | opposite-strand | Winged helix-turn-helix DNA-binding |
| 5 | PF01037.23 | 1.0 | 8 | 1166.5 | opposite-strand | Lrp/AsnC ligand binding domain |
| 6 | PF08280.13 | 1.0 | 8 | 1166.5 | opposite-strand | M protein trans-acting positive regulator (MGA) HTH domain |
| 7 | PF02417.17 | 1.0 | 8 | 293.5 | opposite-strand | Chromate transporter |
| 8 | PF03358.17 | 0.75 | 6 | -3.0 | same-strand | NADPH-dependent FMN reductase |
| 9 | PF02525.19 | 1.0 | 8 | -3.0 | same-strand | Flavodoxin-like fold |
| 10 | PF03466.22 | 1.0 | 8 | 665.0 | opposite-strand | LysR substrate binding domain |
| 11 | PF00126.29 | 1.0 | 8 | 665.0 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 12 | PF04493.16 | 0.88 | 7 | 1634 | same-strand | Endonuclease V |
++ More..