Result : P96721
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YwqI |
| NCBI Accession ID | Z92952.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 8672 |
| Right | 8932 |
| Strand | + |
| Nucleotide Sequence | ATGTCAGAAATTAAGCTGAAGTACGACACAGTCATCAAAACATTAGATTCTGTCAAAGATGCGCTTGCTGACGTATCAATCGGCGCCGCAGGATCCAACGGAAAAAACAGCCTCGATTATACGAAAAAATACCATGAGCGTGAGGAGAACATCAAAACCATGCTCGGAGATTACAAAAAAGCGGTACAGAAAAATATCGAGGATACAAAGGATAACGTAGATTCACTCAAAGAGCAGGACGAGGCGATAGCGGTAAAATAG |
| Sequence | MSEIKLKYDTVIKTLDSVKDALADVSIGAAGSNGKNSLDYTKKYHEREENIKTMLGDYKKAVQKNIEDTKDNVDSLKEQDEAIAVK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17279. Profile Description: Family of unknown function (DUF5344). This is a Bacterial family of unknown function. Most of the members of this family are predicted to contain a coiled-coil region. |
| Pubmed ID | 9353933 9384377 |
| Domain | CDD:407392 |
| Functional Category | Others |
| Uniprot ID | P96721 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3539971 | 3540231 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 2 | 3727427 | 3727687 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 2513217 | 2513477 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 4 | 3550205 | 3550465 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 3521073 | 3521333 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 3596145 | 3596405 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 7 | 3596792 | 3597052 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 8 | 455145 | 455405 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 3590826 | 3591086 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 4302488 | 4302703 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 2605660 | 2605923 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 3880171 | 3880404 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 2764432 | 2764695 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 14 | 4085327 | 4085560 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 15 | 5588839 | 5589129 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 16 | 2110443 | 2110730 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 17 | 2944548 | 2944838 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 18 | 2651422 | 2651679 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 19 | 11310 | 11576 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 20 | 4335129 | 4335395 | + | NZ_CP016020.1 | Bacillus weihaiensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034943.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04740.14 | 0.88 | 14 | 19 | same-strand | LXG domain of WXG superfamily |
| 2 | PF14449.8 | 0.88 | 14 | 19 | same-strand | Pre-toxin TG |
++ More..