Result : P96700
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YdgB |
| NCBI Accession ID | AB001488.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 135659 |
| Right | 135931 |
| Strand | - |
| Nucleotide Sequence | ATGCCGTCTACAGTAATCAACCTATATTATTTGAAGATCAACAGTATTTCGGGCAATGGTTCAATTACAATAGGCGAAGCTGCTTATAACAGCCCTACCAACAATCAAAAATCTCAAGGGACCAACTCTTCTTTCGGTGATACATCACCTACAGAATCCGTAATGGAAAACTTCTTAAACGATCCTGATGTAAATGACCAGACATCTATCGGCAACTCTGATACATCCAACGTTAATGCTCCTCCGATTGCACCACCGCCAATTTTAGATTAA |
| Sequence | MPSTVINLYYLKINSISGNGSITIGEAAYNSPTNNQKSQGTNSSFGDTSPTESVMENFLNDPDVNDQTSIGNSDTSNVNAPPIAPPPILD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10676. Profile Description: Spore germination protein gerPA/gerPF. This is a bacterial family of proteins that are required for the formation of functionally normal spores. Proteins in this family may be involved in establishing normal coat structure and/or permeability which could control the access of germinants to their receptor. |
| Pubmed ID | 9384377 |
| Domain | CDD:371190 |
| Functional Category | Others |
| Uniprot ID | P96700 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 578040 | 578312 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 2 | 602441 | 602713 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 581245 | 581517 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 782975 | 783235 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 5 | 3169495 | 3169755 | + | NZ_CP011937.1 | Bacillus velezensis |
| 6 | 425240 | 425506 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 7 | 424978 | 425220 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 8 | 1543388 | 1543654 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 9 | 2897541 | 2897783 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 10 | 3971633 | 3971875 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP048852.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10676.11 | 1.0 | 9 | 15 | same-strand | Spore germination protein gerPA/gerPF |
| 2 | PF00011.23 | 0.89 | 8 | 273 | same-strand | Hsp20/alpha crystallin family |
++ More..