Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YdgA |
NCBI Accession ID | AB001488.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 135403 |
Right | 135645 |
Strand | - |
Nucleotide Sequence | ATGCCATATCAAATTAATATCGCAAATATTAAGATCAACGGCGTCACGCAAAACGGAAATATAGATGTCGGTCCGACTGTGCACAACAGCCATACTGCGAACAGCAAATATTTTGGAGCAAACTTTTCCTTAGGGGATCTTTCGCCTACGTCTTCACTTTTAAACACTGGAAATATTGATTCAGACGTTAGTGACCAAGACCAAATCGGAAACCCTTCTGCGCCGATTTCAAATCAAATTTAA |
Sequence | MPYQINIANIKINGVTQNGNIDVGPTVHNSHTANSKYFGANFSLGDLSPTSSLLNTGNIDSDVSDQDQIGNPSAPISNQI |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of pfam10676. Profile Description: Spore germination protein gerPA/gerPF. This is a bacterial family of proteins that are required for the formation of functionally normal spores. Proteins in this family may be involved in establishing normal coat structure and/or permeability which could control the access of germinants to their receptor. |
Pubmed ID | 9384377 |
Domain | CDD:371190 |
Functional Category | Others |
Uniprot ID | P96699 |
ORF Length (Amino Acid) | 80 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 602185 | 602427 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 599107 | 599343 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
3 | 577784 | 578026 | - | NZ_CP048852.1 | Bacillus tequilensis |
4 | 574646 | 574882 | - | NZ_CP048852.1 | Bacillus tequilensis |
5 | 580989 | 581231 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
6 | 782718 | 782960 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
7 | 3169770 | 3170012 | + | NZ_CP011937.1 | Bacillus velezensis |
8 | 424978 | 425220 | - | NZ_CP042593.1 | Bacillus dafuensis |
9 | 425240 | 425506 | - | NZ_CP042593.1 | Bacillus dafuensis |
10 | 1543129 | 1543371 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
11 | 2897891 | 2898133 | + | NZ_CP024035.1 | Priestia aryabhattai |
12 | 2897541 | 2897783 | + | NZ_CP024035.1 | Priestia aryabhattai |
13 | 3971888 | 3972130 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00011.23 | 0.89 | 8 | 16 | same-strand | Hsp20/alpha crystallin family |
2 | PF10676.11 | 1.0 | 9 | 17 | same-strand | Spore germination protein gerPA/gerPF |