Result : P96640
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YddC |
| NCBI Accession ID | AB001488.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 71297 |
| Right | 71545 |
| Strand | + |
| Nucleotide Sequence | ATGGATTTCATGAATTTCTTTATTCTTGGCGCAGACCTTCCAACACTTGGAGGGGTAAAAGGTTGGGCATCAGATGTTGTTATCCAATTCATTACGATTGTGGTCATGTTCATAGCCGCAAAGAATCTGATGAAATTAAAAATGGGCGGCATTATCTTTGTTTGCTGTATTGGCAGTGCGGTAACGTGGGTTATTAAACACTGGTCAGAATTCTCCGGCTGGATCAATGCGCTAATGGAAAAATTGTAA |
| Sequence | MDFMNFFILGADLPTLGGVKGWASDVVIQFITIVVMFIAAKNLMKLKMGGIIFVCCIGSAVTWVIKHWSEFSGWINALMEKL |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P96640 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 692987 | 693235 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 2 | 471996 | 472244 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 542672 | 542920 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 4 | 1469423 | 1469671 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 538061 | 538309 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 6 | 256117 | 256374 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP033052.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12642.9 | 1.0 | 5 | 12.0 | same-strand | Conjugative transposon protein TcpC |
| 2 | PF12648.9 | 1.0 | 5 | 13.0 | same-strand | TcpE family |
| 3 | PF12846.9 | 1.0 | 5 | 614.0 | same-strand | AAA-like domain |
| 4 | PF08960.12 | 1.0 | 5 | 2938.0 | same-strand | Domain of unknown function (DUF1874) |
| 5 | PF00877.21 | 0.8 | 4 | 5712 | same-strand | NlpC/P60 family |
| 6 | PF02486.21 | 0.8 | 4 | 2189.5 | same-strand | Replication initiation factor |
| 7 | PF18106.3 | 0.8 | 4 | 2189.5 | same-strand | Rolling Circle replication initiation protein N-terminal domain |
++ More..