Result : P96632
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YdcO |
| NCBI Accession ID | AB001488.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 65528 |
| Right | 65788 |
| Strand | + |
| Nucleotide Sequence | ATGAAAATAAGAGTGAATGCAACAATCATTACTGATGTTGAAGCTTTAAAGGCTGATAAGGATTTGAATCATTTTAAAGACTATGCCACTTGTGAAACATTCGTTGTTGATGCTGATAATCATTTGAAGGCTAATGAAGAAATATCTGAGTTGTTAAAAGGCTGGGATTGGTGGTGTATCTGGTCAACTCGTCCATTGAGTAAAAAGGATAACCAAGTGTTTACTTTGTATAACGATGATTTGTATAACTTATGTCGATAG |
| Sequence | MKIRVNATIITDVEALKADKDLNHFKDYATCETFVVDADNHLKANEEISELLKGWDWWCIWSTRPLSKKDNQVFTLYNDDLYNLCR |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P96632 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 532292 | 532552 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 687058 | 687318 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 477668 | 477928 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 1477212 | 1477472 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 5 | 535912 | 536172 | + | NZ_CP051464.1 | Bacillus mojavensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00589.24 | 1.0 | 4 | 1594 | opposite-strand | Phage integrase family |
| 2 | PF14659.8 | 1.0 | 4 | 1594 | opposite-strand | Phage integrase, N-terminal SAM-like domain |
| 3 | PF13102.8 | 1.0 | 4 | 1594 | opposite-strand | Phage integrase SAM-like domain |
| 4 | PF06114.15 | 1.0 | 4 | 1057 | opposite-strand | IrrE N-terminal-like domain |
| 5 | PF01381.24 | 1.0 | 4 | 678 | opposite-strand | Helix-turn-helix |
| 6 | PF12844.9 | 1.0 | 4 | 678 | opposite-strand | Helix-turn-helix domain |
| 7 | PF13560.8 | 1.0 | 4 | 678 | opposite-strand | Helix-turn-helix domain |
| 8 | PF06125.13 | 1.0 | 4 | 367 | same-strand | Bacterial protein of unknown function (DUF961) |
| 9 | PF02486.21 | 1.0 | 4 | 2217 | same-strand | Replication initiation factor |
| 10 | PF18106.3 | 1.0 | 4 | 2217 | same-strand | Rolling Circle replication initiation protein N-terminal domain |
++ More..