Result : P96609
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YdbN |
| NCBI Accession ID | AB001488.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 39385 |
| Right | 39564 |
| Strand | - |
| Nucleotide Sequence | GTGAATACAAACATGTCAGGAGGGCGCCGGAGCATGCCGAAGCGTAAAGTGAAAACTTACCAACAGCTGATCCAGGAAAACAAAGAGGCGATTATGGGCAATCCAAAGCTGATGAACGTTATTTATGACAGGATCGACCGCAAGCATCAAAAAAATCTGCAAGAGCAAAACAATACATAA |
| Sequence | MNTNMSGGRRSMPKRKVKTYQQLIQENKEAIMGNPKLMNVIYDRIDRKHQKNLQEQNNT |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl16047. Profile Description: Fur-regulated basic protein B. This model describes FbpB (Fur-regulated basic protein B), one of three paralogous small proteins recognized by Pfam model PF13040 in Bacillus subtilis. |
| Pubmed ID | 9384377 |
| Domain | CDD:387731 |
| Functional Category | Others |
| Uniprot ID | P96609 |
| ORF Length (Amino Acid) | 59 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 459640 | 459819 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 2 | 506322 | 506501 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 504918 | 505097 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 483736 | 483915 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 662655 | 662801 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 1503007 | 1503153 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 506378 | 506524 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 3452942 | 3453088 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 497115 | 497261 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 593622 | 593777 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013984.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00375.20 | 0.7 | 7 | 3508 | opposite-strand | Sodium:dicarboxylate symporter family |
| 2 | PF00005.29 | 1.0 | 10 | 2489.0 | opposite-strand | ABC transporter |
| 3 | PF12730.9 | 1.0 | 10 | 1729.0 | opposite-strand | ABC-2 family transporter protein |
| 4 | PF08028.13 | 1.0 | 10 | 26.5 | opposite-strand | Acyl-CoA dehydrogenase, C-terminal domain |
| 5 | PF02770.21 | 1.0 | 10 | 26.5 | opposite-strand | Acyl-CoA dehydrogenase, middle domain |
| 6 | PF13076.8 | 1.0 | 10 | -18.5 | same-strand | Fur-regulated basic protein A |
| 7 | PF01545.23 | 0.9 | 9 | 380 | opposite-strand | Cation efflux family |
| 8 | PF16916.7 | 0.9 | 9 | 380 | opposite-strand | Dimerisation domain of Zinc Transporter |
| 9 | PF00085.22 | 1.0 | 10 | 1263.0 | same-strand | Thioredoxin |
| 10 | PF07478.15 | 1.0 | 10 | 1735.5 | opposite-strand | D-ala D-ala ligase C-terminus |
| 11 | PF01820.23 | 1.0 | 10 | 1735.5 | opposite-strand | D-ala D-ala ligase N-terminus |
| 12 | PF02222.24 | 1.0 | 10 | 1735.5 | opposite-strand | ATP-grasp domain |
| 13 | PF13535.8 | 1.0 | 10 | 1735.5 | opposite-strand | ATP-grasp domain |
| 14 | PF08245.14 | 1.0 | 10 | 2864.0 | opposite-strand | Mur ligase middle domain |
| 15 | PF02875.23 | 1.0 | 10 | 2864.0 | opposite-strand | Mur ligase family, glutamate ligase domain |
| 16 | PF01225.27 | 1.0 | 10 | 2864.0 | opposite-strand | Mur ligase family, catalytic domain |
++ More..