Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L28 |
NCBI Accession ID | U70868.1 |
Organism | Treponema pallidum (strain Nichols) |
Left | 34 |
Right | 270 |
Strand | + |
Nucleotide Sequence | ATGGCAAGAAGATGTGGACTGTGTGGAAAGGGGACGATCAGCGGGTGCGCCGTGAGTAAATCGATGCACCACTGCAAGCGGGTGTGGAAACCGAACCTGCTCGCAGTGAGAGTAGTTGTAGATGGCTCTGCGCTGAACATGCGGATTTGCGCGCGCTGCCTACGCAGCAACCCTCTTATGAAAAAGGCTCAGCCGCGGGCGAACGCGCCGCTAAGGGCGGCGGCGCCCAAGCTCTGA |
Sequence | MARRCGLCGKGTISGCAVSKSMHHCKRVWKPNLLAVRVVVDGSALNMRICARCLRSNPLMKKAQPRANAPLRAAAPKL |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
Pubmed ID | 9665876 |
Domain | CDD:412338 |
Functional Category | Ribosomal_protein |
Uniprot ID | P96131 |
ORF Length (Amino Acid) | 78 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 380655 | 380891 | + | NC_015714.1 | Treponema paraluiscuniculi Cuniculi A |
2 | 2693790 | 2693981 | - | NC_022097.1 | Treponema pedis str. T A4 |
3 | 1017964 | 1018155 | - | NC_002967.9 | Treponema denticola ATCC 35405 |
4 | 418367 | 418558 | + | NZ_CP009228.1 | Treponema putidum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02463.21 | 0.75 | 3 | 3305.0 | opposite-strand | RecF/RecN/SMC N terminal domain |
2 | PF00005.29 | 0.75 | 3 | 3415 | opposite-strand | ABC transporter |