Result : P96131
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | U70868.1 |
| Organism | Treponema pallidum (strain Nichols) |
| Left | 34 |
| Right | 270 |
| Strand | + |
| Nucleotide Sequence | ATGGCAAGAAGATGTGGACTGTGTGGAAAGGGGACGATCAGCGGGTGCGCCGTGAGTAAATCGATGCACCACTGCAAGCGGGTGTGGAAACCGAACCTGCTCGCAGTGAGAGTAGTTGTAGATGGCTCTGCGCTGAACATGCGGATTTGCGCGCGCTGCCTACGCAGCAACCCTCTTATGAAAAAGGCTCAGCCGCGGGCGAACGCGCCGCTAAGGGCGGCGGCGCCCAAGCTCTGA |
| Sequence | MARRCGLCGKGTISGCAVSKSMHHCKRVWKPNLLAVRVVVDGSALNMRICARCLRSNPLMKKAQPRANAPLRAAAPKL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 9665876 |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | P96131 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 380655 | 380891 | + | NC_015714.1 | Treponema paraluiscuniculi Cuniculi A |
| 2 | 2693790 | 2693981 | - | NC_022097.1 | Treponema pedis str. T A4 |
| 3 | 1017964 | 1018155 | - | NC_002967.9 | Treponema denticola ATCC 35405 |
| 4 | 418367 | 418558 | + | NZ_CP009228.1 | Treponema putidum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002967.9
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02463.21 | 0.75 | 3 | 3305.0 | opposite-strand | RecF/RecN/SMC N terminal domain |
| 2 | PF00005.29 | 0.75 | 3 | 3415 | opposite-strand | ABC transporter |
++ More..