Result : P95783
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
| NCBI Accession ID | U31170.1 |
| Organism | Streptococcus mutans serotype c (strain ATCC 700610 / UA159) |
| Left | 757 |
| Right | 960 |
| Strand | + |
| Nucleotide Sequence | ATGTTGAATTTAAAGATTTTAGCACTTGGGATTGCTGTTTTAGGCGTTAGCCTTGGTGAAGGAATTTTAGTTGCTAATATTGCAAAATCTGCAGCTCGTCAGCCTGAAATGTATGGTAAATTACAAACGCTCATGATTATGGGTGTTGCCTTTATTGAAGGTACCTTTTTCGTGCTTCTTGCTTCAACATTCTTTGTTGGCTGA |
| Sequence | MLNLKILALGIAVLGVSLGEGILVANIAKSAARQPEMYGKLQTLMIMGVAFIEGTFFVLLASTFFVG |
| Source of smORF | Swiss-Prot |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
| Pubmed ID | 8996091 12397186 |
| Domain | CDD:412393 |
| Functional Category | Others |
| Uniprot ID | P95783 |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 40
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 166999 | 167202 | + | NZ_CP013237.1 | Streptococcus mutans |
| 2 | 583097 | 583300 | + | NZ_AP014612.1 | Streptococcus troglodytae |
| 3 | 707542 | 707745 | + | NZ_CP039457.1 | Streptococcus pasteurianus |
| 4 | 1620292 | 1620495 | + | NZ_CP054015.1 | Streptococcus gallolyticus |
| 5 | 604905 | 605108 | + | NZ_LS483403.1 | Streptococcus lutetiensis |
| 6 | 873634 | 873837 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 7 | 634599 | 634763 | + | NZ_LS483343.1 | Streptococcus ferus |
| 8 | 1310657 | 1310860 | - | NZ_CP014699.1 | Streptococcus pantholopis |
| 9 | 866301 | 866465 | + | NZ_LR134512.1 | Streptococcus agalactiae |
| 10 | 479877 | 480074 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 11 | 487570 | 487767 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| 12 | 855674 | 855880 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 13 | 1270512 | 1270721 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 14 | 614832 | 614996 | + | NZ_CP034543.1 | Streptococcus periodonticum |
| 15 | 669675 | 669839 | + | NZ_CP012805.1 | Streptococcus anginosus |
| 16 | 1270417 | 1270581 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 17 | 29692 | 29892 | - | NZ_CP043405.1 | Streptococcus ratti |
| 18 | 1170175 | 1170339 | - | NZ_LR594050.1 | Streptococcus porcinus |
| 19 | 2008910 | 2009074 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 20 | 1044403 | 1044606 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 21 | 1560111 | 1560314 | + | NZ_CP015196.1 | Streptococcus marmotae |
| 22 | 311485 | 311685 | - | NZ_CP023392.1 | Lactococcus raffinolactis |
| 23 | 1878835 | 1879035 | - | NZ_CP032620.1 | Streptococcus koreensis |
| 24 | 1188917 | 1189096 | - | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 25 | 1580765 | 1580938 | - | NZ_LR594049.1 | Streptococcus gordonii |
| 26 | 566118 | 566291 | + | NZ_CP010450.1 | Streptococcus pyogenes |
| 27 | 1891023 | 1891196 | - | NZ_LR134293.1 | Streptococcus canis |
| 28 | 773552 | 773725 | + | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 29 | 708099 | 708299 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 30 | 1122717 | 1122917 | - | NC_012924.1 | Streptococcus suis SC84 |
| 31 | 1239269 | 1239469 | - | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 32 | 1392118 | 1392318 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 33 | 1475049 | 1475249 | - | NZ_CP017195.1 | Lactococcus paracarnosus |
| 34 | 984267 | 984467 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 35 | 1418858 | 1419058 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 36 | 1422154 | 1422354 | - | NZ_LT906439.1 | Streptococcus merionis |
| 37 | 1432690 | 1432896 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 38 | 796088 | 796252 | + | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 39 | 1899448 | 1899663 | - | NZ_CP065637.1 | Lactococcus garvieae |
| 40 | 1941792 | 1941959 | + | NZ_CP019082.1 | Paludisphaera borealis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013237.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00119.22 | 1.0 | 40 | 37.0 | same-strand | ATP synthase A chain |
| 2 | PF00430.20 | 1.0 | 40 | 769.0 | same-strand | ATP synthase B/B' CF(0) |
| 3 | PF00213.20 | 1.0 | 40 | 1264.0 | same-strand | ATP synthase delta (OSCP) subunit |
| 4 | PF00006.27 | 0.97 | 39 | 1816 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 5 | PF00306.29 | 1.0 | 40 | 1816.0 | same-strand | ATP synthase alpha/beta chain, C terminal domain |
| 6 | PF02874.25 | 1.0 | 40 | 1816 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
| 7 | PF00231.21 | 0.97 | 39 | 3339 | same-strand | ATP synthase |
++ More..