Result : P95673
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Light-harvesting protein B-800/850 beta 1 chain (Antenna pigment protein beta 1 chain) |
| NCBI Accession ID | S82431.1 |
| Organism | Phaeospirillum molischianum (Rhodospirillum molischianum) |
| Left | 863 |
| Right | 1003 |
| Strand | + |
| Nucleotide Sequence | ATGGCTGAAAGAAGCTTGTCGGGCCTGACCGAGGAAGAGGCGATCGCGGTCCACGACCAGTTCAAGACCACCTTCTCCGCTTTCATCATCCTGGCCGCCGTCGCGCACGTGCTGGTTTGGGTCTGGAAGCCCTGGTTCTGA |
| Sequence | MAERSLSGLTEEEAIAVHDQFKTTFSAFIILAAVAHVLVWVWKPWF |
| Source of smORF | Swiss-Prot |
| Function | Antenna complexes are light-harvesting systems, which transfer the excitation energy to the reaction centers. |
| Pubmed ID | 8695630 8504081 8736556 |
| Domain | |
| Functional Category | Metal-binding |
| Uniprot ID | P95673 |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2165821 | 2165961 | - | NC_018012.1 | Thiocystis violascens DSM 198 |
| 2 | 2167513 | 2167653 | - | NC_018012.1 | Thiocystis violascens DSM 198 |
| 3 | 292662 | 292778 | + | NC_018012.1 | Thiocystis violascens DSM 198 |
| 4 | 2166301 | 2166417 | - | NC_018012.1 | Thiocystis violascens DSM 198 |
| 5 | 2167989 | 2168105 | - | NC_018012.1 | Thiocystis violascens DSM 198 |
| 6 | 2173966 | 2174109 | - | NC_018012.1 | Thiocystis violascens DSM 198 |
| 7 | 2283623 | 2283763 | - | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 8 | 2281608 | 2281748 | - | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 9 | 2282062 | 2282205 | - | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 10 | 2284077 | 2284220 | - | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 11 | 2561996 | 2562130 | - | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 12 | 2911529 | 2911669 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 13 | 2881278 | 2881403 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 14 | 820925 | 821071 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 15 | 3122063 | 3122197 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 16 | 822128 | 822271 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 17 | 2911998 | 2912132 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 18 | 2991379 | 2991504 | - | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 19 | 3017259 | 3017402 | + | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 20 | 3017568 | 3017711 | + | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 21 | 2995109 | 2995252 | - | NZ_CP007031.1 | Marichromatium purpuratum 984 |
| 22 | 1176563 | 1176712 | + | NZ_CP013729.1 | Roseateles depolymerans |
| 23 | 3116498 | 3116659 | - | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 24 | 1024320 | 1024454 | + | NZ_CP015963.1 | Altererythrobacter ishigakiensis |
| 25 | 1236485 | 1236628 | + | NZ_CP019240.1 | Rhodoferax antarcticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP007031.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00556.22 | 1.0 | 8 | 442.0 | same-strand | Antenna complex alpha/beta subunit |
| 2 | PF02276.20 | 0.62 | 5 | 1193.5 | same-strand | Photosynthetic reaction centre cytochrome C subunit |
| 3 | PF00124.21 | 0.88 | 7 | 1260.0 | same-strand | Photosynthetic reaction centre protein |
| 4 | PF00142.20 | 0.75 | 6 | 3146.5 | same-strand | 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family |
| 5 | PF00148.21 | 0.62 | 5 | 1578.5 | same-strand | Nitrogenase component 1 type Oxidoreductase |
| 6 | PF08369.12 | 0.62 | 5 | 136 | same-strand | Proto-chlorophyllide reductase 57 kD subunit |
| 7 | PF01656.25 | 0.62 | 5 | 3116 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
++ More..