Result : P95262
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative antitoxin VapB14 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 2200726 |
| Right | 2200941 |
| Strand | + |
| Nucleotide Sequence | GTGATCCGCAACCTTCCCGAGGGGACCAAGGCGGCACTACGGGTCCGTGCTGCACGTCATCACCACTCCGTCGAAGCGGAAGCCCGCGCGATCCTCACCGCGGGATTGTTGGGCGAAGAAGTCCCCATGCCGGTACTGCTGGCCGCCGACAGTGGCCATGACATCGACTTCGAGCCCGAACGTCTCGGCCTGATCGCCCGCACCCCGCAACTGTGA |
| Sequence | MIRNLPEGTKAALRVRAARHHHSVEAEARAILTAGLLGEEVPMPVLLAADSGHDIDFEPERLGLIARTPQL |
| Source of smORF | Swiss-Prot |
| Function | Putative antitoxin component of a possible type II toxin-antitoxin (TA) system. The cognate toxin is VapB14. {ECO:0000305|Pubmed:15718296}. |
| Pubmed ID | 9634230 15718296 |
| Domain | CDD:227035 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P95262 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2200726 | 2200941 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 2244735 | 2244950 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 2225793 | 2226020 | - | NZ_CP045929.1 | Saccharopolyspora coralli |
| 4 | 2426901 | 2427116 | + | NZ_CP026734.1 | Brevibacterium linens |
| 5 | 1083499 | 1083678 | - | NZ_LT985188.1 | Micropruina glycogenica |
| 6 | 960980 | 961168 | + | NZ_LT985188.1 | Micropruina glycogenica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP045929.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 0.6 | 3 | -3 | same-strand | PIN domain |
++ More..