Protein Information |
Information Type | Description |
---|---|
Protein name | Putative antitoxin VapB14 |
NCBI Accession ID | AL123456.3 |
Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
Left | 2200726 |
Right | 2200941 |
Strand | + |
Nucleotide Sequence | GTGATCCGCAACCTTCCCGAGGGGACCAAGGCGGCACTACGGGTCCGTGCTGCACGTCATCACCACTCCGTCGAAGCGGAAGCCCGCGCGATCCTCACCGCGGGATTGTTGGGCGAAGAAGTCCCCATGCCGGTACTGCTGGCCGCCGACAGTGGCCATGACATCGACTTCGAGCCCGAACGTCTCGGCCTGATCGCCCGCACCCCGCAACTGTGA |
Sequence | MIRNLPEGTKAALRVRAARHHHSVEAEARAILTAGLLGEEVPMPVLLAADSGHDIDFEPERLGLIARTPQL |
Source of smORF | Swiss-Prot |
Function | Putative antitoxin component of a possible type II toxin-antitoxin (TA) system. The cognate toxin is VapB14. {ECO:0000305|Pubmed:15718296}. |
Pubmed ID | 9634230 15718296 |
Domain | CDD:227035 |
Functional Category | Antitoxin_type_2 |
Uniprot ID | P95262 |
ORF Length (Amino Acid) | 71 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2200726 | 2200941 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
2 | 2244735 | 2244950 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
3 | 2225793 | 2226020 | - | NZ_CP045929.1 | Saccharopolyspora coralli |
4 | 2426901 | 2427116 | + | NZ_CP026734.1 | Brevibacterium linens |
5 | 1083499 | 1083678 | - | NZ_LT985188.1 | Micropruina glycogenica |
6 | 960980 | 961168 | + | NZ_LT985188.1 | Micropruina glycogenica |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01850.23 | 0.6 | 3 | -3 | same-strand | PIN domain |