Result : A6Q1Q4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) |
| NCBI Accession ID | AP009178.1 |
| Organism | Nitratiruptor sp. (strain SB155-2) |
| Left | 291636 |
| Right | 291938 |
| Strand | + |
| Nucleotide Sequence | ATGATTACGTTGACACATTATCTCATATTGTCTGCCATACTGTTTAGTATAGCGCTTGTAGGTATTTTACGAAGAAAAAATCTATTAATGCTCTTTTTTGCGACAGAAATTGCACTCAATGCTGTAAACATTGCATTAGCTGCATTTTCGAAATATTATGGGGACTTAACAGGCCAACTTTTCGCATTTTTCATTATAGCCATTGCGGCTAGTGAAGTGGCAGTTGGTCTTGGACTTTTGATTATATGGTACAAACGTAGAGGCACTATCGATCTCGACAGCCTCCAATCTATGAATGGGTAA |
| Sequence | MITLTHYLILSAILFSIALVGILRRKNLLMLFFATEIALNAVNIALAAFSKYYGDLTGQLFAFFIIAIAASEVAVGLGLLIIWYKRRGTIDLDSLQSMNG |
| Source of smORF | Swiss-Prot |
| Function | NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. {ECO:0000255|HAMAP-Rule:MF_01456}. |
| Pubmed ID | 17615243 |
| Domain | CDD:412408 |
| Functional Category | Others |
| Uniprot ID | A6Q1Q4 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 98
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 137380 | 137682 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 2 | 150969 | 151271 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 3 | 192316 | 192618 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 4 | 196336 | 196638 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 5 | 2588111 | 2588413 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 6 | 1815272 | 1815517 | - | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 7 | 1710279 | 1710524 | - | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 8 | 1900933 | 1901238 | - | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 9 | 2965528 | 2965827 | - | NZ_CP053836.1 | Halarcobacter ebronensis |
| 10 | 240689 | 240991 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 11 | 2722667 | 2722966 | - | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 12 | 483224 | 483526 | + | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 13 | 2868313 | 2868612 | - | NZ_CP053835.1 | Arcobacter defluvii |
| 14 | 1261647 | 1261949 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 15 | 2648952 | 2649251 | - | NZ_CP032097.1 | Arcobacter ellisii |
| 16 | 3002136 | 3002435 | - | NZ_CP053840.1 | Arcobacter venerupis |
| 17 | 2674351 | 2674650 | - | NZ_CP031218.1 | Malaciobacter halophilus |
| 18 | 218749 | 219051 | + | NZ_AP022826.1 | Nitrosophilus labii |
| 19 | 213076 | 213378 | - | NZ_CP012541.1 | Campylobacter concisus |
| 20 | 2749342 | 2749641 | - | NZ_CP019070.1 | Poseidonibacter parvus |
| 21 | 2379061 | 2379360 | - | NZ_CP030944.1 | Arcobacter aquimarinus |
| 22 | 2498168 | 2498467 | - | NZ_CP053833.1 | Arcobacter cloacae |
| 23 | 2844500 | 2844799 | - | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 24 | 2488165 | 2488464 | - | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 25 | 99760 | 100059 | - | NZ_CP053837.1 | Aliarcobacter faecis |
| 26 | 521688 | 521990 | - | NZ_CP021886.1 | Helicobacter apodemus |
| 27 | 398999 | 399298 | - | NZ_CP054051.1 | Aliarcobacter cibarius |
| 28 | 2850490 | 2850789 | - | NZ_CP041070.1 | Arcobacter anaerophilus |
| 29 | 265254 | 265502 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 30 | 1672173 | 1672475 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 31 | 157322 | 157624 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 32 | 222565 | 222867 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 33 | 904336 | 904638 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 34 | 91711 | 92013 | + | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 35 | 100087 | 100389 | + | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 36 | 1331598 | 1331900 | + | NC_017379.1 | Helicobacter pylori Puno135 |
| 37 | 185301 | 185603 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 38 | 2550623 | 2550922 | - | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 39 | 151307 | 151609 | + | NZ_CP053841.1 | Campylobacter blaseri |
| 40 | 821730 | 822032 | - | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 41 | 2656243 | 2656542 | - | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 42 | 2725057 | 2725356 | - | NZ_CP042812.1 | Malaciobacter canalis |
| 43 | 2777556 | 2777855 | - | NZ_CP032101.1 | Malaciobacter marinus |
| 44 | 2994615 | 2994914 | - | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 45 | 2503394 | 2503693 | - | NZ_CP035928.1 | Malaciobacter pacificus |
| 46 | 2382723 | 2383028 | - | NZ_CP035708.1 | Sphaerotilus natans subsp. sulfidivorans |
| 47 | 1523304 | 1523606 | - | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 48 | 643502 | 643804 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 49 | 1501081 | 1501344 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 50 | 99033 | 99332 | + | NZ_CP053842.1 | Campylobacter corcagiensis |
| 51 | 1422628 | 1422933 | + | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 52 | 1381445 | 1381708 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 53 | 296295 | 296555 | + | NZ_CP012196.1 | Campylobacter gracilis |
| 54 | 4066917 | 4067222 | + | NZ_CP059560.1 | Aromatoleum petrolei |
| 55 | 2123933 | 2124238 | - | NZ_AP014879.1 | Sulfuricaulis limicola |
| 56 | 2875608 | 2875913 | + | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 57 | 699128 | 699433 | - | NZ_CP059467.1 | Aromatoleum bremense |
| 58 | 3351375 | 3351680 | - | NZ_CP064781.1 | Azospira restricta |
| 59 | 1229402 | 1229707 | + | NZ_CP022579.1 | Oryzomicrobium terrae |
| 60 | 254272 | 254559 | - | NZ_CP035946.1 | Campylobacter canadensis |
| 61 | 216480 | 216785 | - | NZ_CP023449.1 | Rhizorhabdus dicambivorans |
| 62 | 3280749 | 3281054 | + | NC_009511.1 | Sphingomonas wittichii RW1 |
| 63 | 150065 | 150367 | - | NZ_CP053826.1 | Campylobacter curvus |
| 64 | 453021 | 453326 | + | NZ_CP014646.1 | Thauera humireducens |
| 65 | 1688326 | 1688631 | - | NZ_CP010554.1 | Rugosibacter aromaticivorans |
| 66 | 2350353 | 2350658 | - | NZ_CP027860.1 | Ahniella affigens |
| 67 | 2470608 | 2470913 | - | NZ_AP014936.1 | Sulfurifustis variabilis |
| 68 | 2051547 | 2051852 | + | NZ_CP028339.1 | Thauera aromatica K172 |
| 69 | 3157028 | 3157333 | - | NZ_CP018839.1 | Thauera chlorobenzoica |
| 70 | 727048 | 727350 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 71 | 1619684 | 1619989 | + | NZ_CP016210.1 | Azoarcus olearius |
| 72 | 1239294 | 1239569 | - | NZ_CP014991.1 | Helicobacter himalayensis |
| 73 | 2057355 | 2057660 | - | NZ_CP029331.1 | Thauera hydrothermalis |
| 74 | 1271286 | 1271594 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 75 | 259688 | 259996 | + | NZ_CP018845.1 | Herbaspirillum robiniae |
| 76 | 1914188 | 1914496 | + | NZ_CP013737.1 | Herbaspirillum rubrisubalbicans M1 |
| 77 | 2007226 | 2007534 | + | NZ_CP011930.1 | Herbaspirillum seropedicae |
| 78 | 2013697 | 2014005 | + | NZ_CP037993.1 | Herbaspirillum huttiense |
| 79 | 2156799 | 2157107 | + | NZ_CP013232.1 | Collimonas fungivorans |
| 80 | 3846416 | 3846721 | - | NZ_LN614827.1 | Legionella fallonii LLAP-10 |
| 81 | 1056699 | 1056947 | + | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 82 | 2005532 | 2005780 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 83 | 1649828 | 1650133 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 84 | 4897174 | 4897476 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 85 | 3462551 | 3462859 | - | NZ_CP013236.1 | Collimonas pratensis |
| 86 | 329160 | 329459 | + | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 87 | 329823 | 330086 | + | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 88 | 16486 | 16788 | + | NC_013943.1 | Denitrovibrio acetiphilus DSM 12809 |
| 89 | 384180 | 384479 | + | NZ_CP035108.1 | Geovibrio thiophilus |
| 90 | 769945 | 770196 | + | NZ_CP071057.1 | Marinicauda algicola |
| 91 | 218936 | 219229 | + | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 92 | 2531331 | 2531582 | - | NC_015942.1 | Acidithiobacillus ferrivorans SS3 |
| 93 | 530375 | 530623 | + | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
| 94 | 572335 | 572586 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 95 | 226869 | 227171 | + | NZ_LR698974.1 | Candidatus Methanomassiliicoccus intestinalis |
| 96 | 4377348 | 4377656 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 97 | 1456201 | 1456464 | - | NZ_CP020478.1 | Campylobacter helveticus |
| 98 | 1707126 | 1707428 | - | NC_015676.1 | Methanosalsum zhilinae DSM 4017 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_018002.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10588.11 | 0.94 | 92 | 2212.5 | same-strand | NADH-ubiquinone oxidoreductase-G iron-sulfur binding region |
| 2 | PF13510.8 | 0.94 | 92 | 2212.5 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
| 3 | PF13237.8 | 0.98 | 96 | 597 | same-strand | 4Fe-4S dicluster domain |
| 4 | PF13183.8 | 0.85 | 83 | 587.5 | same-strand | 4Fe-4S dicluster domain |
| 5 | PF13187.8 | 1.0 | 98 | 685.5 | same-strand | 4Fe-4S dicluster domain |
| 6 | PF00146.23 | 1.0 | 98 | 1198.0 | same-strand | NADH dehydrogenase |
| 7 | PF00037.29 | 0.99 | 97 | 645.0 | same-strand | 4Fe-4S binding domain |
| 8 | PF12838.9 | 1.0 | 98 | 692 | same-strand | 4Fe-4S dicluster domain |
| 9 | PF00499.22 | 0.98 | 96 | 0.0 | same-strand | NADH-ubiquinone/plastoquinone oxidoreductase chain 6 |
| 10 | PF00361.22 | 1.0 | 98 | 1912.0 | same-strand | Proton-conducting membrane transporter |
| 11 | PF00662.22 | 1.0 | 98 | 4.0 | same-strand | NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus |
| 12 | PF14697.8 | 0.6 | 59 | 680 | same-strand | 4Fe-4S dicluster domain |
++ More..