Protein Information |
Information Type | Description |
---|---|
Protein name | Putative antitoxin VapB19 |
NCBI Accession ID | AL123456.3 |
Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
Left | 2868606 |
Right | 2868863 |
Strand | + |
Nucleotide Sequence | ATGCGGACTCAGGTGACCCTGGGCAAAGAGGAGCTTGAGCTGCTCGATCGTGCCGCCAAGGCGAGTGGCGCATCGCGGTCCGAACTCATCCGACGCGCAATTCACCGTGCCTACGGGACTGGATCCAAGCAGGAACGGCTCGCCGCGCTCGACCACAGCCGTGGCTCGTGGCGAGGACGGGACTTCACCGGCACCGAGTATGTCGACGCCATTCGGGGCGACCTCAACGAACGACTTGCTCGGCTCGGTCTGGCGTGA |
Sequence | MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLARLGLA |
Source of smORF | Swiss-Prot |
Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin VapC19. {ECO:0000269|Pubmed:20011113, ECO:0000305|Pubmed:15718296}. |
Pubmed ID | 9634230 15718296 20011113 |
Domain | CDD:419885 |
Functional Category | Antitoxin_type_2 |
Uniprot ID | P95006 |
ORF Length (Amino Acid) | 85 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2868606 | 2868863 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
2 | 2938293 | 2938550 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
3 | 2106585 | 2106842 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
4 | 3602208 | 3602465 | - | NZ_AP022606.1 | Mycobacterium branderi |
5 | 186468 | 186725 | + | NZ_AP022607.1 | Mycobacterium branderi |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF16708.7 | 0.75 | 3 | 1479 | same-strand | Lipoprotein confined to pathogenic Mycobacterium |
2 | PF01850.23 | 1.0 | 4 | 39 | same-strand | PIN domain |