Result : P95006

Protein Information

• Protein name: Putative antitoxin VapB19
• NCBI Accession ID: AL123456.3
• Organism: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
• Left: 2868606
• Right: 2868863
• Strand: +
• Nucleotide Sequence: ATGCGGACTCAGGTGACCCTGGGCAAAGAGGAGCTTGAGCTGCTCGATCGTGCCGCCAAGGCGAGTGGCGCATCGCGGTCCGAACTCATCCGACGCGCAATTCACCGTGCCTACGGGACTGGATCCAAGCAGGAACGGCTCGCCGCGCTCGACCACAGCCGTGGCTCGTGGCGAGGACGGGACTTCACCGGCACCGAGTATGTCGACGCCATTCGGGGCGACCTCAACGAACGACTTGCTCGGCTCGGTCTGGCGTGA
• Sequence: MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLARLGLA
• Source of smORF: Swiss-Prot
• Function: Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin VapC19. {ECO:0000269|Pubmed:20011113, ECO:0000305|Pubmed:15718296}.
• Pubmed ID: 9634230 15718296 20011113
• Domain: CDD:419885
• Functional Category: Antitoxin_type_2
• Uniprot ID: P95006
• ORF Length (Amino Acid): 85

Conservation Analysis

No. of Species: 4

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2868606	2868863	+	NC_000962.3	Mycobacterium tuberculosis H37Rv
2	2938293	2938550	+	NC_015848.1	Mycobacterium canettii CIPT 140010059
3	2106585	2106842	+	NZ_AP022575.1	Mycobacterium shinjukuense
4	3602208	3602465	-	NZ_AP022606.1	Mycobacterium branderi
5	186468	186725	+	NZ_AP022607.1	Mycobacterium branderi

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000962.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF16708.7	0.75	3	1479	same-strand	Lipoprotein confined to pathogenic Mycobacterium
2	PF01850.23	1.0	4	39	same-strand	PIN domain