Result : P94533
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YsfE |
| NCBI Accession ID | Z75208.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 29726 |
| Right | 29968 |
| Strand | + |
| Nucleotide Sequence | TTGGCGCTTAATACCCGGGAAAGCGCCAGAGACATCACGGCGCTGGACATTCCGGATACATCTGCTTCAAACACATTTGAAATCGGGTTTGTTACTGAAAATGTAGAAGCGGTCATCAAAAGGATGAGAGAACAAGGCGTATCGATTATCGGGGAGCCGAAAGTGAAACCATGGGGGCAGACGGTCGCCTATATCGCTGATCCGGATGGACATTATATCGAAATTTGCAGTCCGATGGAATAA |
| Sequence | MALNTRESARDITALDIPDTSASNTFEIGFVTENVEAVIKRMREQGVSIIGEPKVKPWGQTVAYIADPDGHYIEICSPME |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 8969504 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P94533 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2935967 | 2936209 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2752954 | 2753196 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 2812863 | 2813105 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 2820256 | 2820498 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 2747030 | 2747272 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 2740972 | 2741217 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3360566 | 3360811 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 2854389 | 2854610 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 9 | 2884447 | 2884668 | - | NC_011725.1 | Bacillus cereus B4264 |
| 10 | 2777330 | 2777569 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 11 | 237400 | 237639 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 12 | 1084871 | 1085074 | + | NZ_CP043404.1 | Bacillus safensis |
| 13 | 1160437 | 1160640 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 14 | 2941625 | 2941846 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 15 | 2332542 | 2332781 | + | NZ_CP040336.1 | Bacillus luti |
| 16 | 3755454 | 3755651 | + | NZ_CP013023.1 | Paenibacillus bovis |
++ More..