Result : P94519
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YsdA |
| NCBI Accession ID | Z75208.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 13762 |
| Right | 14031 |
| Strand | + |
| Nucleotide Sequence | ATGATTATTGCTGCTTATTTGGTGTTGATTAATCTGTGCGGTTTTTGGGTGATGGGCATTGACAAACGCAAAGCGCAGCAGCACAAGTGGAGAATTTCTGAAGACCGGCTGTGGCTGATAGCCATCGTGTTTGGAGCGCTCGGTGTCTGGCTTGGCATGCAAACCTTCAGACATAAAACGAAACACGCTTCTTTTAAGTACGGAGTACCGCTTCTTCTGGTAATAGAAGCGATTCTCATCGCTATTTACTACAGCCCGTTTGATTTATAA |
| Sequence | MIIAAYLVLINLCGFWVMGIDKRKAQQHKWRISEDRLWLIAIVFGALGVWLGMQTFRHKTKHASFKYGVPLLLVIEAILIAIYYSPFDL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01311. Profile Description: Protein of unknown function (DUF1294). This family includes a number of hypothetical bacterial and archaeal proteins of unknown function. |
| Pubmed ID | 8969504 9384377 |
| Domain | CDD:412837 |
| Functional Category | Others |
| Uniprot ID | P94519 |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 42
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2951898 | 2952167 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2768888 | 2769157 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 2830676 | 2830945 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 2764848 | 2765117 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 3342722 | 3342991 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 2836462 | 2836731 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 2757085 | 2757354 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 1196924 | 1197190 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 2790692 | 2790958 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 3763293 | 3763526 | - | NZ_CP053989.1 | Niallia circulans |
| 11 | 3294057 | 3294296 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 12 | 2918555 | 2918797 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 3578675 | 3578923 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 14 | 1213306 | 1213542 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 15 | 2820050 | 2820286 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 16 | 4141142 | 4141387 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 17 | 3104376 | 3104639 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 18 | 2019258 | 2019518 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 19 | 2572384 | 2572620 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 20 | 1321276 | 1321536 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 21 | 3628515 | 3628754 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 22 | 1004570 | 1004806 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 23 | 978400 | 978624 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 24 | 2412923 | 2413180 | - | NZ_CP028842.1 | Clostridium botulinum |
| 25 | 3139394 | 3139630 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 26 | 365983 | 366240 | - | NZ_CP030280.1 | Blautia argi |
| 27 | 1446123 | 1446365 | + | NZ_LS483476.1 | Lederbergia lentus |
| 28 | 3337007 | 3337261 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 29 | 3251238 | 3251456 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 30 | 3697037 | 3697279 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 31 | 2181670 | 2181915 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 32 | 551085 | 551336 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 33 | 2737083 | 2737334 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 34 | 3185806 | 3186057 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 35 | 1371209 | 1371460 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 36 | 1622964 | 1623230 | - | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 37 | 986908 | 987129 | + | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 38 | 628699 | 628920 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 39 | 942487 | 942759 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 40 | 1117357 | 1117614 | + | NC_014033.1 | Prevotella ruminicola 23 |
| 41 | 1719865 | 1720083 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 42 | 4970921 | 4971157 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05343.16 | 0.67 | 28 | 597.0 | same-strand | M42 glutamyl aminopeptidase |
| 2 | PF01546.30 | 0.67 | 28 | 597.0 | same-strand | Peptidase family M20/M25/M40 |
| 3 | PF00453.20 | 0.76 | 32 | 91.5 | same-strand | Ribosomal protein L20 |
| 4 | PF01632.21 | 0.76 | 32 | 483.0 | same-strand | Ribosomal protein L35 |
| 5 | PF00707.24 | 0.76 | 32 | 702.0 | same-strand | Translation initiation factor IF-3, C-terminal domain |
| 6 | PF05198.18 | 0.76 | 32 | 702.0 | same-strand | Translation initiation factor IF-3, N-terminal domain |
++ More..