Result : P94496
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sporulation protein cse60 |
| NCBI Accession ID | U70041.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 672 |
| Right | 854 |
| Strand | + |
| Nucleotide Sequence | ATGCTGAAGGTAGCGGTATTTGATGAAGAGCATGAAAAAGACTTACAAACGGAAATCAATTCATTTTTAAAAGGGATATCGGAGGAGCAGCTGATAGATATCAAATATACGGTTTCGGCGGCGTGCGACCCAGACGGCGAGCAGCTTTACTGTTTTTCCGCCCTTATTTTATATCGCAAATAA |
| Sequence | MLKVAVFDEEHEKDLQTEINSFLKGISEEQLIDIKYTVSAACDPDGEQLYCFSALILYRK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10957. Profile Description: Sporulation protein Cse60. Cse60 is expressed during sporulation in Bacillus subtilis. Transcription commences around 2h after the start of sporulation and had an absolute requirement for the transcription factor sigmaE. Cse60 is an acidic product of only 60 residues, whose function is not known. |
| Pubmed ID | 8990290 9384377 |
| Domain | CDD:337871 |
| Functional Category | Others |
| Uniprot ID | P94496 |
| ORF Length (Amino Acid) | 60 |
++ More..
| Conservation Analysis |
No. of Species: 44
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2952230 | 2952412 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 2 | 2896821 | 2897003 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 2880400 | 2880582 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 4 | 2957380 | 2957562 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 3078393 | 3078575 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 6 | 2872660 | 2872842 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 3215653 | 3215835 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 2914017 | 2914199 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 1068342 | 1068524 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 3435134 | 3435316 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 3041312 | 3041494 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 3226419 | 3226601 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 13 | 2603487 | 2603669 | + | NZ_CP043404.1 | Bacillus safensis |
| 14 | 2696915 | 2697097 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 15 | 2705603 | 2705785 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 16 | 928357 | 928545 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 2478050 | 2478229 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 18 | 162653 | 162832 | - | NZ_CP015439.1 | Anoxybacillus amylolyticus |
| 19 | 1112090 | 1112269 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 20 | 3757897 | 3758076 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 21 | 2582030 | 2582221 | - | NZ_CP012024.1 | Bacillus smithii |
| 22 | 3070252 | 3070434 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 23 | 2908059 | 2908244 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 24 | 3448523 | 3448705 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 25 | 1102800 | 1102985 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 26 | 1318975 | 1319157 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 27 | 2999260 | 2999442 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 28 | 427943 | 428122 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 29 | 3887849 | 3888031 | - | NZ_CP053989.1 | Niallia circulans |
| 30 | 2864785 | 2864964 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 31 | 1045529 | 1045708 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 32 | 3059879 | 3060058 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 33 | 2077650 | 2077829 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 34 | 3784827 | 3785009 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 35 | 3962603 | 3962788 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 36 | 4716175 | 4716357 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 37 | 662655 | 662837 | + | NZ_CP040336.1 | Bacillus luti |
| 38 | 4509183 | 4509365 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 39 | 4672874 | 4673056 | - | NC_011725.1 | Bacillus cereus B4264 |
| 40 | 4536864 | 4537046 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 41 | 3549008 | 3549190 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 42 | 3141536 | 3141718 | - | NZ_LS483476.1 | Lederbergia lentus |
| 43 | 3713114 | 3713296 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 44 | 1972302 | 1972487 | + | NZ_CP017703.1 | Aeribacillus pallidus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP033052.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00849.24 | 0.66 | 29 | 3765 | same-strand | RNA pseudouridylate synthase |
| 2 | PF01479.27 | 0.66 | 29 | 3765 | same-strand | S4 domain |
| 3 | PF01943.19 | 0.75 | 33 | 1620 | same-strand | Polysaccharide biosynthesis protein |
| 4 | PF14667.8 | 0.75 | 33 | 1620 | same-strand | Polysaccharide biosynthesis C-terminal domain |
| 5 | PF03023.16 | 0.73 | 32 | 1627.0 | same-strand | Lipid II flippase MurJ |
| 6 | PF03486.16 | 0.89 | 39 | 1749 | opposite-strand | HI0933-like protein |
++ More..