Result : P94485

Protein Information

• Protein name: Uncharacterized protein YnaG
• NCBI Accession ID: U66480.1
• Organism: Bacillus subtilis (strain 168)
• Left: 11368
• Right: 11643
• Strand: +
• Nucleotide Sequence: ATGAATGTTAAAAAAGCTGCAGCTGTTTTTTCAATCACTATTCCAATTATCTCAGCCATCTTAATTATTAATTTTTTTACAGGATTTATGTCAATTCCATGGCAAGGAATGCCGGTGTTTTTTCCATTATTACTTTCTCCTATAGGAATCATTTTAGCGTTCGTTTCAATAAAGACAAATAAACGGTGTGCTGTATATGGGATTGTCTTAAATGCAATTATGTTTCCATTTCCTTTTTTCTGGTTTATCGGAGGGGCTTTGTTATTTGGAGTTTAA
• Sequence: MNVKKAAAVFSITIPIISAILIINFFTGFMSIPWQGMPVFFPLLLSPIGIILAFVSIKTNKRCAVYGIVLNAIMFPFPFFWFIGGALLFGV
• Source of smORF: Swiss-Prot
• Pubmed ID: 9384377
• Functional Category: Others
• Uniprot ID: P94485
• ORF Length (Amino Acid): 91

Conservation Analysis

No. of Species: 4

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1885365	1885640	+	NC_000964.3	Bacillus subtilis subsp. subtilis str. 168
2	1997597	1997872	-	NZ_CP051464.1	Bacillus mojavensis
3	1993200	1993475	-	NZ_CP013984.1	Bacillus inaquosorum
4	4063636	4063911	+	NZ_CP029364.1	Bacillus halotolerans

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP051464.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF13302.9	0.75	3	1687	same-strand	Acetyltransferase (GNAT) domain
2	PF00583.27	0.75	3	1687	same-strand	Acetyltransferase (GNAT) family
3	PF17094.7	0.75	3	85	same-strand	Uncharacterised protein family (UPF0715)