Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YnaG |
NCBI Accession ID | U66480.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 11368 |
Right | 11643 |
Strand | + |
Nucleotide Sequence | ATGAATGTTAAAAAAGCTGCAGCTGTTTTTTCAATCACTATTCCAATTATCTCAGCCATCTTAATTATTAATTTTTTTACAGGATTTATGTCAATTCCATGGCAAGGAATGCCGGTGTTTTTTCCATTATTACTTTCTCCTATAGGAATCATTTTAGCGTTCGTTTCAATAAAGACAAATAAACGGTGTGCTGTATATGGGATTGTCTTAAATGCAATTATGTTTCCATTTCCTTTTTTCTGGTTTATCGGAGGGGCTTTGTTATTTGGAGTTTAA |
Sequence | MNVKKAAAVFSITIPIISAILIINFFTGFMSIPWQGMPVFFPLLLSPIGIILAFVSIKTNKRCAVYGIVLNAIMFPFPFFWFIGGALLFGV |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9384377 |
Domain | |
Functional Category | Others |
Uniprot ID | P94485 |
ORF Length (Amino Acid) | 91 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1885365 | 1885640 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 1997597 | 1997872 | - | NZ_CP051464.1 | Bacillus mojavensis |
3 | 1993200 | 1993475 | - | NZ_CP013984.1 | Bacillus inaquosorum |
4 | 4063636 | 4063911 | + | NZ_CP029364.1 | Bacillus halotolerans |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13302.9 | 0.75 | 3 | 1687 | same-strand | Acetyltransferase (GNAT) domain |
2 | PF00583.27 | 0.75 | 3 | 1687 | same-strand | Acetyltransferase (GNAT) family |
3 | PF17094.7 | 0.75 | 3 | 85 | same-strand | Uncharacterised protein family (UPF0715) |