Result : P94425
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative monooxygenase YcnE (EC 1.-.-.-) |
| NCBI Accession ID | D50453.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 118515 |
| Right | 118802 |
| Strand | - |
| Nucleotide Sequence | ATGATCGTATTACAAGCTTACATCAAAGTAAAACCAGAAAAACGCGAGGAATTTTTGAGCGAGGCTCAATCACTTGTTCAGCATTCAAGAGCTGAGGAAGGCAACGCGCAATACGACCTATTCGAAAAAGTAGGCGAAGAAAATACATTTGTCATGCTTGAAAAATGGAAAGATGAAGCGGCAATGAAATTCCATAACGAAACTGCGCATTTCCAAGGGTTTGTCGCAAAAGGAAAAGAACTGCTGAGCGCTCCTCTTGATGTTGTCCGCACAGAGCTTAGCGAGTAA |
| Sequence | MIVLQAYIKVKPEKREEFLSEAQSLVQHSRAEEGNAQYDLFEKVGEENTFVMLEKWKDEAAMKFHNETAHFQGFVAKGKELLSAPLDVVRTELSE |
| Source of smORF | Swiss-Prot |
| Function | Putative monooxygenase that may contribute to the degradation of aromatic compounds. {ECO:0000305}. |
| Pubmed ID | 8969502 9384377 17218307 17407181 |
| Domain | CDD:415830 |
| Functional Category | Others |
| Uniprot ID | P94425 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 27
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 439282 | 439569 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 391998 | 392285 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 595365 | 595652 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 4 | 437657 | 437944 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 5 | 436551 | 436838 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 1571649 | 1571936 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 415370 | 415657 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 430061 | 430348 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 3523706 | 3523993 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 474147 | 474434 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 514888 | 515172 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 12 | 530436 | 530723 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 13 | 3131184 | 3131477 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 14 | 2805770 | 2806060 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 15 | 2561055 | 2561348 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 16 | 5174987 | 5175280 | - | NZ_CP021434.1 | Tumebacillus avium |
| 17 | 614924 | 615220 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 18 | 4742793 | 4743086 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 19 | 617340 | 617633 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 20 | 1061963 | 1062256 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 21 | 1722920 | 1723213 | + | NZ_CP043404.1 | Bacillus safensis |
| 22 | 3571034 | 3571327 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 23 | 572333 | 572623 | + | NZ_CP009288.1 | Paenibacillus durus |
| 24 | 1788008 | 1788301 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 25 | 2997928 | 2998212 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 26 | 523284 | 523580 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 27 | 1421491 | 1421790 | + | NZ_CP013023.1 | Paenibacillus bovis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00881.26 | 0.81 | 22 | 19.0 | same-strand | Nitroreductase family |
| 2 | PF01022.22 | 0.89 | 24 | 205 | opposite-strand | Bacterial regulatory protein, arsR family |
| 3 | PF12840.9 | 0.85 | 23 | 205 | opposite-strand | Helix-turn-helix domain |
++ More..