Protein Information |
Information Type | Description |
---|---|
Protein name | Negative regulatory protein YxlD |
NCBI Accession ID | D83026.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 54071 |
Right | 54277 |
Strand | + |
Nucleotide Sequence | ATGACACAAACAGAAATTATCATAACGGTTGCGGCTTGTCTCATCGTATTGGCGCAGGGAATCTTTTTATTTATTGATGCGAAAAAACGTAATCACATGGCATGGGTTTGGGGGATTGTCGGATTGATTCAAGCACCGATGCCTCTGATTTGTTATTACTTTTTTGTCATTAGGCCGGATCGGAAGAAAAGGGGGATCAAGCAATGA |
Sequence | MTQTEIIITVAACLIVLAQGIFLFIDAKKRNHMAWVWGIVGLIQAPMPLICYYFFVIRPDRKKRGIKQ |
Source of smORF | Swiss-Prot |
Function | Together with YxlE, is important for negative regulation of sigma Y activity, being the major negative regulator. {ECO:0000269|Pubmed:12897008}. |
Pubmed ID | 8969509 9384377 12897008 14769884 |
Domain | |
Functional Category | Others |
Uniprot ID | P94372 |
ORF Length (Amino Acid) | 68 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3969796 | 3970002 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 3857482 | 3857688 | - | NZ_CP013984.1 | Bacillus inaquosorum |
3 | 3797224 | 3797430 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
4 | 3854435 | 3854641 | - | NZ_CP033052.1 | Bacillus vallismortis |
5 | 3791154 | 3791357 | - | NZ_CP048852.1 | Bacillus tequilensis |
6 | 3784769 | 3784972 | - | NZ_CP051464.1 | Bacillus mojavensis |
7 | 2266780 | 2266983 | + | NZ_CP029364.1 | Bacillus halotolerans |
8 | 4135764 | 4135970 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
9 | 21539 | 21760 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
10 | 4341380 | 4341583 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
11 | 1790064 | 1790276 | + | NZ_CP043404.1 | Bacillus safensis |
12 | 1859101 | 1859310 | + | NZ_CP017786.1 | Bacillus xiamenensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00005.29 | 1.0 | 12 | 2395 | same-strand | ABC transporter |
2 | PF13732.8 | 0.83 | 10 | 195.0 | same-strand | Domain of unknown function (DUF4162) |
3 | PF13396.8 | 0.83 | 10 | -3.0 | same-strand | Phospholipase D-nuclease N-terminal |
4 | PF17280.4 | 1.0 | 12 | -1.5 | same-strand | Family of unknown function (DUF5345) |
5 | PF04542.16 | 1.0 | 12 | 310.0 | same-strand | Sigma-70 region 2 |
6 | PF04545.18 | 1.0 | 12 | 310.0 | same-strand | Sigma-70, region 4 |
7 | PF08281.14 | 1.0 | 12 | 310.0 | same-strand | Sigma-70, region 4 |
8 | PF07638.13 | 1.0 | 12 | 310.0 | same-strand | ECF sigma factor |
9 | PF00664.25 | 0.75 | 9 | 3362 | same-strand | ABC transporter transmembrane region |