Result : P94353
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YxjJ |
| NCBI Accession ID | D83026.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 26981 |
| Right | 27244 |
| Strand | - |
| Nucleotide Sequence | TTGTTATTTATTGATTTAGAATTTTTTGAATACTTTTTGGCATTTTATCCGTACAATAGAGAGTACCAAAACTTTTTTTGGGAGGTATGTAATATGATCCTATTTATTATCATCGCATTATGCGGCTATCTTCTTTTTTCTTTCAGCAAGGACAATCGCCGCAAACCGCAAAAGACAAGCCCTCTGCCAGCAGCCGCACCTCATCACAACAACCTAATCGACCTTGACGCCATCCGCCAAAAACGCCGGATGCATCTTTCCTAA |
| Sequence | MLFIDLEFFEYFLAFYPYNREYQNFFWEVCNMILFIIIALCGYLLFSFSKDNRRKPQKTSPLPAAAPHHNNLIDLDAIRQKRRMHLS |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 8969509 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P94353 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3996829 | 3997092 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3822258 | 3822485 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 3882239 | 3882466 | + | NZ_CP013984.1 | Bacillus inaquosorum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07730.15 | 0.67 | 2 | 2467.5 | same-strand | Histidine kinase |
| 2 | PF00072.26 | 0.67 | 2 | 1824.5 | same-strand | Response regulator receiver domain |
| 3 | PF00196.21 | 0.67 | 2 | 1824.5 | same-strand | Bacterial regulatory proteins, luxR family |
| 4 | PF01546.30 | 1.0 | 3 | 560 | same-strand | Peptidase family M20/M25/M40 |
| 5 | PF07687.16 | 1.0 | 3 | 560 | same-strand | Peptidase dimerisation domain |
| 6 | PF04525.14 | 1.0 | 3 | 175 | same-strand | LURP-one-related |
| 7 | PF01717.20 | 1.0 | 3 | 1640.5 | same-strand | Cobalamin-independent synthase, Catalytic domain |
| 8 | PF13561.8 | 1.0 | 3 | 3495 | opposite-strand | Enoyl-(Acyl carrier protein) reductase |
| 9 | PF00106.27 | 1.0 | 3 | 3495 | opposite-strand | short chain dehydrogenase |
| 10 | PF08659.12 | 1.0 | 3 | 3495 | opposite-strand | KR domain |
| 11 | PF01144.25 | 1.0 | 3 | 4285 | opposite-strand | Coenzyme A transferase |
++ More..