Result : A6LSF9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0473 protein Cbei_1107 |
| NCBI Accession ID | CP000721.1 |
| Organism | Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) (Clostridium acetobutylicum) |
| Left | 1321910 |
| Right | 1322188 |
| Strand | + |
| Nucleotide Sequence | ATGGATAAGGAAGCAAAATATGTATATATACCTGATCAAGAAGGAAATGATGTTAAGTTTGAGGTTATTATATACTTTGAAATAGAAAAATTAAAAGGCCAATATATTATTGCAACTCCTGCATTTGAAGAAACTGATGAAGCTTATGCTTTTAAGATATTCAAAGATGAGGATGGAAGCGATATATTTATAGCTTTAGAAGATGACGATGAAGAATTCGAAATGGTATTAGAAACTTATGAAACTCTTATGAATGAAGATGGTTTAATTGAGGAATAG |
| Sequence | MDKEAKYVYIPDQEGNDVKFEVIIYFEIEKLKGQYIIATPAFEETDEAYAFKIFKDEDGSDIFIALEDDDEEFEMVLETYETLMNEDGLIEE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01608. Profile Description: Protein of unknown function (DUF1292). hypothetical protein; Provisional |
| Pubmed ID | |
| Domain | CDD:412983 |
| Functional Category | Others |
| Uniprot ID | A6LSF9 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1320167 | 1320445 | + | NZ_CP043998.1 | Clostridium diolis |
| 2 | 1378822 | 1379100 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 3 | 1086101 | 1086379 | + | NZ_CP030775.1 | Clostridium butyricum |
| 4 | 1503090 | 1503368 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_020291.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01594.18 | 1.0 | 4 | 4278.5 | same-strand | AI-2E family transporter |
| 2 | PF01411.21 | 1.0 | 4 | 1071.0 | same-strand | tRNA synthetases class II (A) |
| 3 | PF02272.21 | 1.0 | 4 | 1071.0 | same-strand | DHHA1 domain |
| 4 | PF07973.16 | 1.0 | 4 | 1071.0 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
| 5 | PF06135.14 | 1.0 | 4 | 674.0 | same-strand | IreB regulatory phosphoprotein |
| 6 | PF03652.17 | 1.0 | 4 | 201.0 | same-strand | Holliday junction resolvase |
| 7 | PF01475.21 | 1.0 | 4 | 73.5 | same-strand | Ferric uptake regulator family |
| 8 | PF17770.3 | 1.0 | 4 | 608.0 | same-strand | Ribonuclease J C-terminal domain |
| 9 | PF00009.29 | 1.0 | 4 | 2583.5 | same-strand | Elongation factor Tu GTP binding domain |
| 10 | PF00679.26 | 1.0 | 4 | 2583.5 | same-strand | Elongation factor G C-terminus |
| 11 | PF03144.27 | 1.0 | 4 | 2583.5 | same-strand | Elongation factor Tu domain 2 |
| 12 | PF01926.25 | 1.0 | 4 | 2583.5 | same-strand | 50S ribosome-binding GTPase |
| 13 | PF02618.18 | 1.0 | 4 | 4505.0 | same-strand | YceG-like family |
| 14 | PF01596.19 | 1.0 | 4 | 5548.0 | same-strand | O-methyltransferase |
| 15 | PF13578.8 | 1.0 | 4 | 5548.0 | same-strand | Methyltransferase domain |
| 16 | PF08241.14 | 0.75 | 3 | 5539 | same-strand | Methyltransferase domain |
| 17 | PF05239.18 | 0.75 | 3 | 5257 | same-strand | PRC-barrel domain |
++ More..