Protein Information |
Information Type | Description |
---|---|
Protein name | Lantibiotic lichenicidin VK21 A2 (LchA2) |
NCBI Accession ID | GU949560.1 |
Organism | Bacillus licheniformis |
Left | 37 |
Right | 255 |
Strand | - |
Nucleotide Sequence | ATGAAAACAATGAAAAATTCAGCTGCCCGTGAAGCCTTCAAAGGAGCCAATCATCCGGCAGGGATGGTTTCCGAAGAGGAATTGAAAGCTTTGGTAGGAGGAAATGACGTCAATCCTGAAACAACTCCTGCTACAACCTCTTCTTGGACTTGCATCACAGCCGGTGTAACGGTTTCTGCTTCATTATGCCCAACAACTAAGTGTACAAGCCGATGCTAG |
Sequence | MKTMKNSAAREAFKGANHPAGMVSEEELKALVGGNDVNPETTPATTSSWTCITAGVTVSASLCPTTKCTSRC |
Source of smORF | Swiss-Prot |
Function | Lanthionine-containing peptide antibiotic (lantibiotic) active on Gram-positive bacteria. The bactericidal activity of lantibiotics is based on depolarization of energized bacterial cytoplasmic membranes, initiated by the formation of aqueous transmembrane pores. When present individually, LchA2 exhibits activity towards B.subtilis L1 (IC(50)=30 uM), Rhodococcus sp. SS2 (IC(50)=16.6 uM), M.luteus B1314 (IC(50)=2.6 uM), B.megaterium VKM41 (IC(50)=2 uM), S.aureus 209p (IC(50)=20 uM), B.pumilus 2001, B.globigii I, B.amyloliquefaciens I, M.smegmatis 1171 and M.phlei 1291. However, when combined with LchA1, it displays much stronger activity against B.subtilis L1 (IC(50)=0.64 uM), Rhodococcus sp. SS2 (IC(50)=0.64 uM), M.luteus B1314 (IC(50)=0.09 uM), B.megaterium VKM41 (IC(50)=0.12 uM) and S.aureus 209p (IC(50)=0.64 uM). The activity of the combined LchA1 and LchA2 peptides is strongest at a molar ratio of 1. Even when applied at 17-fold concentration of the highest IC(50) values for Gram-positive bacteria, neither the individual nor the combined peptides display activity against Gram-negative bacteria P.aeruginosa PAO1, P.putida I-97 or E.coli C600. {ECO:0000269|Pubmed:20578714}. |
Pubmed ID | 20578714 |
Domain | CDD:301355 |
Functional Category | Antimicrobial |
Uniprot ID | P86476 |
ORF Length (Amino Acid) | 72 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3949444 | 3949662 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
2 | 5702637 | 5702858 | - | NZ_CP009288.1 | Paenibacillus durus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13783.8 | 1.0 | 2 | 6775.0 | same-strand | Domain of unknown function (DUF4177) |
2 | PF00082.24 | 1.0 | 2 | 5429.5 | same-strand | Subtilase family |
3 | PF00005.29 | 1.0 | 2 | 4021.5 | same-strand | ABC transporter |
4 | PF00664.25 | 1.0 | 2 | 3367 | same-strand | ABC transporter transmembrane region |
5 | PF03412.17 | 1.0 | 2 | 3300.0 | same-strand | Peptidase C39 family |
6 | PF13575.8 | 1.0 | 2 | 345.0 | both-strands | Domain of unknown function (DUF4135) |
7 | PF05147.15 | 1.0 | 2 | 345.0 | both-strands | Lanthionine synthetase C-like protein |
8 | PF14867.8 | 1.0 | 2 | 135.5 | opposite-strand | Lantibiotic alpha |