ProsmORF-pred
Result : P86475
Protein Information
Information Type Description
Protein name Lantibiotic lichenicidin VK21 A1 (LchA1)
NCBI Accession ID GU949560.1
Organism Bacillus licheniformis
Left 393
Right 617
Strand +
Nucleotide Sequence ATGTCAAAAAAGGAAATGATTCTTTCATGGAAAAATCCTATGTATCGCACTGAATCTTCTTATCATCCAGCAGGGAACATCCTTAAAGAACTCCAGGAAGAGGAACAGCACAGCATCGCCGGAGGCACAATCACGCTCAGCACTTGTGCCATCTTGAGCAAGCCGTTAGGAAATAACGGATACCTGTGTACAGTGACAAAAGAATGCATGCCAAGCTGTAACTAA
Sequence MSKKEMILSWKNPMYRTESSYHPAGNILKELQEEEQHSIAGGTITLSTCAILSKPLGNNGYLCTVTKECMPSCN
Source of smORF Swiss-Prot
Function Lanthionine-containing peptide antibiotic (lantibiotic) active on Gram-positive bacteria. The bactericidal activity of lantibiotics is based on depolarization of energized bacterial cytoplasmic membranes, initiated by the formation of aqueous transmembrane pores. When present individually, LchA1 exhibits activity towards B.subtilis L1 (IC(50)=9 uM), Rhodococcus sp. SS2 (IC(50)=9 uM), M.luteus B1314 (IC(50)=1.2 uM), B.megaterium VKM41 (IC(50)=1.8 uM), S.aureus 209p (IC(50)=3.1 uM), B.pumilus 2001, B.globigii I, B.amyloliquefaciens I, M.smegmatis 1171 and M.phlei 1291. However, when combined with LchA2, it displays much stronger activity against B.subtilis L1 (IC(50)=0.64 uM), Rhodococcus sp. SS2 (IC(50)=0.64 uM), M.luteus B1314 (IC(50)=0.09 uM), B.megaterium VKM41 (IC(50)=0.12 uM) and S.aureus 209p (IC(50)=0.64 uM). The activity of the combined LchA1 and LchA2 peptides is strongest at a molar ratio of 1. Even when applied at 17-fold concentration of the highest IC(50) values for Gram-positive bacteria, neither the individual nor the combined peptides display activity against Gram-negative bacteria P.aeruginosa PAO1, P.putida I-97 or E.coli C600. {ECO:0000269|Pubmed:20578714}.
Pubmed ID 20578714
Domain CDD:333722,CDD:291529
Functional Category Antimicrobial
Uniprot ID P86475
ORF Length (Amino Acid) 74
++ More..