Result : P82543
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cytochrome c oxidase polypeptide 2A (EC 7.1.1.9) (Cytochrome c ba(3) subunit IIA) (Cytochrome c oxidase polypeptide IIA) (Cytochrome cba3 subunit 2A) |
| NCBI Accession ID | AP008226.1 |
| Organism | Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) |
| Left | 1075522 |
| Right | 1075626 |
| Strand | + |
| Nucleotide Sequence | ATGGAAGAAAAGCCCAAAGGCGCACTGGCGGTCATCCTGGTCCTGACCCTCACCATCCTGGTCTTCTGGCTGGGAGTGTACGCCGTCTTCTTCGCTAGGGGGTAG |
| Sequence | MEEKPKGALAVILVLTLTILVFWLGVYAVFFARG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam08113. Profile Description: Cytochrome c oxidase subunit IIa family. This family consists of the cytochrome c oxidase subunit IIa family. The bax-type cytochrome c oxidase from Thermus thermophilus is known as a two subunit enzyme. From its crystal structure, it was discovered that an additional transmembrane helix 'subunit IIa' spans the membrane. This subunit consists of 34 residues forming one helix across the membrane. The presence of this subunit seems to be important for the function of cytochrome c oxidases. |
| Pubmed ID | 11152118 10775261 |
| Domain | CDD:285350 |
| Functional Category | Others |
| Uniprot ID | P82543 |
| ORF Length (Amino Acid) | 34 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1075522 | 1075626 | + | NC_006461.1 | Thermus thermophilus HB8 |
| 2 | 913291 | 913395 | - | NZ_CP014141.1 | Thermus parvatiensis |
| 3 | 326284 | 326388 | - | NZ_CP038452.1 | Thermus caldilimi |
| 4 | 191926 | 192030 | + | NZ_CP016312.1 | Thermus brockianus |
| 5 | 648515 | 648619 | - | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 6 | 1443405 | 1443509 | + | NC_019386.1 | Thermus oshimai JL-2 |
| 7 | 344963 | 345070 | + | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 8 | 1698326 | 1698436 | + | NC_014761.1 | Oceanithermus profundus DSM 14977 |
| 9 | 2020048 | 2020155 | - | NC_014212.1 | Meiothermus silvanus DSM 9946 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_006461.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01546.30 | 0.67 | 6 | 1291.0 | opposite-strand | Peptidase family M20/M25/M40 |
| 2 | PF07687.16 | 0.67 | 6 | 1291.0 | opposite-strand | Peptidase dimerisation domain |
| 3 | PF03259.19 | 0.67 | 6 | 782.0 | same-strand | Roadblock/LC7 domain |
| 4 | PF09125.12 | 0.89 | 8 | 4.0 | same-strand | Cytochrome C oxidase subunit II, transmembrane |
| 5 | PF00115.22 | 1.0 | 9 | 513 | same-strand | Cytochrome C and Quinol oxidase polypeptide I |
| 6 | PF00312.24 | 0.89 | 8 | 3940.5 | same-strand | Ribosomal protein S15 |
++ More..