Result : P82291

Protein Information

• Protein name: Soluble cytochrome b558
• Organism: Ectothiorhodospira shaposhnikovii (Ectothiorhodospira vacuolata)
• Sequence: MNETEATLPVFTLEQVAEHHSPDDCWMAIHGKVYDLTPYVPNHPGPAGMMLVWCGQESTEAWETKSYGEPHSSLAARLLQRYLIGTLEEIT
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of cl02041. Profile Description: Cytochrome b5-like Heme/Steroid binding domain. This family includes heme binding domains from a diverse range of proteins. This family also includes proteins that bind to steroids. The family includes progesterone receptors. Many members of this subfamily are membrane anchored by an N-terminal transmembrane alpha helix. This family also includes a domain in some chitin synthases. There is no known ligand for this domain in the chitin synthases.
• Pubmed ID: 10585439
• Domain: CDD:413168
• Functional Category: Metal-binding
• Uniprot ID: P82291
• ORF Length (Amino Acid): 91

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	913171	913395	-	NZ_CP012154.1	Wenzhouxiangella marina
2	3448535	3448762	+	NZ_CP059467.1	Aromatoleum bremense
3	842912	843151	+	NC_017583.1	Spirochaeta thermophila DSM 6578

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP012154.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00175.23	0.67	2	139.5	same-strand	Oxidoreductase NAD-binding domain
2	PF01794.21	0.67	2	139.5	same-strand	Ferric reductase like transmembrane component
3	PF08281.14	0.67	2	3797.5	both-strands	Sigma-70, region 4