Protein Information |
Information Type | Description |
---|---|
Protein name | Soluble cytochrome b558 |
NCBI Accession ID | |
Organism | Ectothiorhodospira shaposhnikovii (Ectothiorhodospira vacuolata) |
Left | |
Right | |
Strand | |
Nucleotide Sequence | |
Sequence | MNETEATLPVFTLEQVAEHHSPDDCWMAIHGKVYDLTPYVPNHPGPAGMMLVWCGQESTEAWETKSYGEPHSSLAARLLQRYLIGTLEEIT |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl02041. Profile Description: Cytochrome b5-like Heme/Steroid binding domain. This family includes heme binding domains from a diverse range of proteins. This family also includes proteins that bind to steroids. The family includes progesterone receptors. Many members of this subfamily are membrane anchored by an N-terminal transmembrane alpha helix. This family also includes a domain in some chitin synthases. There is no known ligand for this domain in the chitin synthases. |
Pubmed ID | 10585439 |
Domain | CDD:413168 |
Functional Category | Metal-binding |
Uniprot ID | P82291 |
ORF Length (Amino Acid) | 91 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 913171 | 913395 | - | NZ_CP012154.1 | Wenzhouxiangella marina |
2 | 3448535 | 3448762 | + | NZ_CP059467.1 | Aromatoleum bremense |
3 | 842912 | 843151 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00175.23 | 0.67 | 2 | 139.5 | same-strand | Oxidoreductase NAD-binding domain |
2 | PF01794.21 | 0.67 | 2 | 139.5 | same-strand | Ferric reductase like transmembrane component |
3 | PF08281.14 | 0.67 | 2 | 3797.5 | both-strands | Sigma-70, region 4 |