Protein Information |
Information Type | Description |
---|---|
Protein name | Competence protein S |
NCBI Accession ID | U10926.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 211 |
Right | 351 |
Strand | + |
Nucleotide Sequence | TTGAACCGATCAGGCAAGCATCTTATCAGCAGCATTATCCTGTATCCCCGGCCCAGCGGAGAATGTATATCCTCAATCAGCTTGGACAAGCAAACACAAGCTACAACGTCCCCGCTGTACTTCTGCTGGAGGGAGAAGTAG |
Sequence | MNRSGKHLISSIILYPRPSGECISSISLDKQTQATTSPLYFCWREK |
Source of smORF | Swiss-Prot |
Function | Required for the development of competence. |
Pubmed ID | 7752896 7937777 7831343 8441623 8355609 8969502 9384377 |
Domain | CDD:340299 |
Functional Category | Others |
Uniprot ID | P80355 |
ORF Length (Amino Acid) | 46 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 390880 | 391020 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 373827 | 373967 | + | NZ_CP048852.1 | Bacillus tequilensis |
3 | 388537 | 388677 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
4 | 546470 | 546610 | + | NZ_CP033052.1 | Bacillus vallismortis |
5 | 387492 | 387632 | + | NZ_CP051464.1 | Bacillus mojavensis |
6 | 1620146 | 1620286 | - | NZ_CP029364.1 | Bacillus halotolerans |
7 | 158022 | 158162 | + | NZ_CP013984.1 | Bacillus inaquosorum |
8 | 3574885 | 3575025 | - | NZ_CP011937.1 | Bacillus velezensis |
9 | 379026 | 379166 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01380.24 | 0.89 | 8 | 15720.5 | opposite-strand | SIS domain |
2 | PF00215.26 | 0.89 | 8 | 15083.0 | opposite-strand | Orotidine 5'-phosphate decarboxylase / HUMPS family |
3 | PF01638.19 | 0.89 | 8 | 14490.5 | same-strand | HxlR-like helix-turn-helix |
4 | PF00668.22 | 1.0 | 9 | 3149.0 | same-strand | Condensation domain |
5 | PF00501.30 | 1.0 | 9 | 3149 | same-strand | AMP-binding enzyme |
6 | PF00550.27 | 1.0 | 9 | 3149.0 | same-strand | Phosphopantetheine attachment site |
7 | PF13193.8 | 1.0 | 9 | 3149 | same-strand | AMP-binding enzyme C-terminal domain |
8 | PF00975.22 | 0.89 | 8 | 9444.5 | same-strand | Thioesterase domain |
9 | PF12697.9 | 0.89 | 8 | 11371.0 | same-strand | Alpha/beta hydrolase family |
10 | PF14317.8 | 0.67 | 6 | 13436.5 | opposite-strand | YcxB-like protein |