Protein Information |
Information Type | Description |
---|---|
Protein name | Cytochrome c oxidase subunit 4 (EC 7.1.1.9) (Cytochrome aa3 subunit 4) (Cytochrome c oxidase polypeptide IV) |
NCBI Accession ID | Y08372.1 |
Organism | Paracoccus denitrificans |
Left | 175 |
Right | 327 |
Strand | + |
Nucleotide Sequence | ATGGCCTCGCATCACGAAATCACCGATCACAAGCACGGCGAAATGGACATCCGTCATCAGCAGGCGACCTTTGCCGGCTTCATCAAGGGCGCGACCTGGGTCAGCATCCTTTCCATAGCCGTGCTGGTGTTCCTGGCCCTGGCCAACTCCTGA |
Sequence | MASHHEITDHKHGEMDIRHQQATFAGFIKGATWVSILSIAVLVFLALANS |
Source of smORF | Swiss-Prot |
Function | Not required for enzymatic activity or proton pumping of the cytochrome c oxidase complex. {ECO:0000269|Pubmed:9038156}. |
Pubmed ID | 9038156 8068652 7651515 |
Domain | CDD:400267 |
Functional Category | Others |
Uniprot ID | P77921 |
ORF Length (Amino Acid) | 50 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1074643 | 1074795 | - | NZ_CP045073.1 | Paracoccus kondratievae |
2 | 2794363 | 2794515 | + | NZ_LN832559.1 | Paracoccus aminovorans |
3 | 1156209 | 1156361 | + | NZ_CP030239.1 | Paracoccus mutanolyticus |
4 | 678248 | 678400 | + | NZ_CP024422.1 | Paracoccus yeei |
5 | 206714 | 206866 | - | NC_022041.1 | Paracoccus aminophilus JCM 7686 |
6 | 2522516 | 2522668 | - | NZ_CP025430.1 | Paracoccus zhejiangensis |
7 | 102785 | 102919 | + | NZ_CP034348.1 | Roseovarius faecimaris |
8 | 2278055 | 2278204 | - | NZ_CP025583.1 | Paracoccus jeotgali |
9 | 1314052 | 1314186 | - | NZ_CP012023.1 | Celeribacter marinus |
10 | 2018720 | 2018866 | + | NZ_CP034328.1 | Tabrizicola piscis |
11 | 1824240 | 1824374 | + | NZ_CP024899.1 | Rhodobaca barguzinensis |
12 | 4247579 | 4247713 | + | NZ_CP045201.1 | Pseudopuniceibacterium antarcticum |
13 | 4410843 | 4410977 | - | NZ_CP004393.1 | Celeribacter indicus |
14 | 2260511 | 2260645 | - | NZ_CP022196.1 | Celeribacter ethanolicus |
15 | 143832 | 143966 | + | NZ_CP012661.1 | Defluviimonas alba |
16 | 2099410 | 2099544 | - | NZ_CP060436.1 | Pseudooceanicola algae |
17 | 653307 | 653447 | - | NZ_CP004372.1 | Roseibacterium elongatum DSM 19469 |
18 | 2824349 | 2824483 | - | NZ_CP061498.1 | Roseicitreum antarcticum |
19 | 917944 | 918078 | + | NZ_CP054599.1 | Sulfitobacter pseudonitzschiae |
20 | 1632219 | 1632353 | + | NZ_CP014327.1 | Halocynthiibacter arcticus |
21 | 233089 | 233223 | + | NZ_CP065915.1 | Pelagovum pacificum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03591.16 | 0.71 | 15 | 991 | opposite-strand | AzlC protein |
2 | PF05437.14 | 0.76 | 16 | 666.0 | opposite-strand | Branched-chain amino acid transport protein (AzlD) |
3 | PF00753.29 | 0.95 | 20 | 297.5 | same-strand | Metallo-beta-lactamase superfamily |
4 | PF00441.26 | 1.0 | 21 | 1175 | same-strand | Acyl-CoA dehydrogenase, C-terminal domain |
5 | PF02770.21 | 1.0 | 21 | 1175 | same-strand | Acyl-CoA dehydrogenase, middle domain |
6 | PF12806.9 | 0.86 | 18 | 1377.0 | same-strand | Acetyl-CoA dehydrogenase C-terminal like |
7 | PF08028.13 | 0.9 | 19 | 1482 | same-strand | Acyl-CoA dehydrogenase, C-terminal domain |
8 | PF01300.20 | 0.86 | 18 | 2983.5 | opposite-strand | Telomere recombination |
9 | PF03481.15 | 0.81 | 17 | 2991 | opposite-strand | Putative GTP-binding controlling metal-binding |
10 | PF02622.17 | 0.62 | 13 | 3971 | same-strand | Uncharacterized ACR, COG1678 |