Protein Information |
Information Type | Description |
---|---|
Protein name | Light-harvesting protein B-800/850 alpha chain (Antenna pigment protein alpha chain) (LH2 alpha polypeptide) |
NCBI Accession ID | U67155.1 |
Organism | Rubrivivax gelatinosus (Rhodocyclus gelatinosus) (Rhodopseudomonas gelatinosa) |
Left | 832 |
Right | 1047 |
Strand | + |
Nucleotide Sequence | ATGAACCAAGGCAAAGTCTGGCGCGTCGTTAAGCCGACCGTTGGTGTTCCCGTTTACCTGGGCGCCGTCGCCGTTACGGCCCTGATCCTGCACGGTGGCCTGCTGGCCAAGACCGACTGGTTCGGCGCCTACTGGAACGGTGGCAAGAAGGCTGCTGCGGCTGCTGCCGCCGTCGCCCCGGCCCCGGTCGCGGCTCCGCAAGCTCCGGCGCAGTAA |
Sequence | MNQGKVWRVVKPTVGVPVYLGAVAVTALILHGGLLAKTDWFGAYWNGGKKAAAAAAAVAPAPVAAPQAPAQ |
Source of smORF | Swiss-Prot |
Function | Antenna complexes are light-harvesting systems, which transfer the excitation energy to the reaction centers. |
Pubmed ID | 8020505 16228472 |
Domain | |
Functional Category | Metal-binding |
Uniprot ID | P77799 |
ORF Length (Amino Acid) | 71 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2233590 | 2233772 | + | NZ_CP061202.1 | Rhodobacter capsulatus |
2 | 1569116 | 1569295 | + | NZ_CP058907.1 | Rhodopseudomonas palustris |
3 | 2897372 | 2897551 | - | NZ_CP058907.1 | Rhodopseudomonas palustris |
4 | 1021081 | 1021275 | + | NZ_CP020470.1 | Rhodobacter blasticus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00556.22 | 1.0 | 3 | 23.5 | same-strand | Antenna complex alpha/beta subunit |
2 | PF03209.17 | 1.0 | 3 | 144 | same-strand | PUCC protein |
3 | PF00072.26 | 0.67 | 2 | 2969.5 | both-strands | Response regulator receiver domain |