Result : P77799
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Light-harvesting protein B-800/850 alpha chain (Antenna pigment protein alpha chain) (LH2 alpha polypeptide) |
| NCBI Accession ID | U67155.1 |
| Organism | Rubrivivax gelatinosus (Rhodocyclus gelatinosus) (Rhodopseudomonas gelatinosa) |
| Left | 832 |
| Right | 1047 |
| Strand | + |
| Nucleotide Sequence | ATGAACCAAGGCAAAGTCTGGCGCGTCGTTAAGCCGACCGTTGGTGTTCCCGTTTACCTGGGCGCCGTCGCCGTTACGGCCCTGATCCTGCACGGTGGCCTGCTGGCCAAGACCGACTGGTTCGGCGCCTACTGGAACGGTGGCAAGAAGGCTGCTGCGGCTGCTGCCGCCGTCGCCCCGGCCCCGGTCGCGGCTCCGCAAGCTCCGGCGCAGTAA |
| Sequence | MNQGKVWRVVKPTVGVPVYLGAVAVTALILHGGLLAKTDWFGAYWNGGKKAAAAAAAVAPAPVAAPQAPAQ |
| Source of smORF | Swiss-Prot |
| Function | Antenna complexes are light-harvesting systems, which transfer the excitation energy to the reaction centers. |
| Pubmed ID | 8020505 16228472 |
| Domain | |
| Functional Category | Metal-binding |
| Uniprot ID | P77799 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2233590 | 2233772 | + | NZ_CP061202.1 | Rhodobacter capsulatus |
| 2 | 1569116 | 1569295 | + | NZ_CP058907.1 | Rhodopseudomonas palustris |
| 3 | 2897372 | 2897551 | - | NZ_CP058907.1 | Rhodopseudomonas palustris |
| 4 | 1021081 | 1021275 | + | NZ_CP020470.1 | Rhodobacter blasticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP058907.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00556.22 | 1.0 | 3 | 23.5 | same-strand | Antenna complex alpha/beta subunit |
| 2 | PF03209.17 | 1.0 | 3 | 144 | same-strand | PUCC protein |
| 3 | PF00072.26 | 0.67 | 2 | 2969.5 | both-strands | Response regulator receiver domain |
++ More..