ProsmORF-pred
Result : P77714
Protein Information
Information Type Description
Protein name Ferredoxin-like protein YdiT
NCBI Accession ID U00096.3
Organism Escherichia coli (strain K12)
Left 1782681
Right 1782974
Strand +
Nucleotide Sequence ATGAGCCAGAACGCTACGGTTAACGTCGACATCAAATTAGGCGTCAATAAATTCCATGTTGATGAGGGCCACCCGCATATCATTCTGGCGGAAAATCCCGATATCAATGAATTCCATAAATTAATGAAAGCCTGCCCTGCCGGACTTTATAAGCAGGATGACGCAGGAAACATTCATTTTGATTCCGCCGGTTGTCTGGAGTGCGGCACCTGTCGGGTGCTGTGCGGTAACACTATTCTCGAACAGTGGCAATATCCCGCAGGCACCTTCGGTATTGATTTTCGCTACGGCTAA
Sequence MSQNATVNVDIKLGVNKFHVDEGHPHIILAENPDINEFHKLMKACPAGLYKQDDAGNIHFDSAGCLECGTCRVLCGNTILEQWQYPAGTFGIDFRYG
Source of smORF Swiss-Prot
Function Could be a 3Fe-4S cluster-containing protein. Probably participates in a redox process with YdiQ, YdiR and YdiS.
Pubmed ID 9097039 9278503 16738553
Domain CDD:418523
Functional Category Metal-binding
Uniprot ID P77714
ORF Length (Amino Acid) 97
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 66
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1782681 1782974 + NC_000913.3 Escherichia coli str. K-12 substr. MG1655
2 45481 45750 + NC_000913.3 Escherichia coli str. K-12 substr. MG1655
3 2382532 2382825 + NC_002695.2 Escherichia coli O157:H7 str. Sakai
4 49895 50164 + NC_002695.2 Escherichia coli O157:H7 str. Sakai
5 1973515 1973808 - NZ_CP061527.1 Shigella dysenteriae
6 3550169 3550438 - NZ_CP061527.1 Shigella dysenteriae
7 1564033 1564326 - NC_004337.2 Shigella flexneri 2a str. 301
8 44795 45064 + NC_004337.2 Shigella flexneri 2a str. 301
9 1717352 1717645 + NZ_AP014857.1 Escherichia albertii
10 48749 49018 + NZ_AP014857.1 Escherichia albertii
11 3113353 3113610 - NZ_AP014857.1 Escherichia albertii
12 4840349 4840642 - NZ_CP033744.1 Citrobacter freundii
13 3486692 3486961 + NZ_CP033744.1 Citrobacter freundii
14 229884 230177 + NZ_CP044098.1 Citrobacter portucalensis
15 1567498 1567734 - NZ_CP044098.1 Citrobacter portucalensis
16 692938 693231 - NZ_CP038469.1 Citrobacter tructae
17 2632028 2632264 - NZ_CP038469.1 Citrobacter tructae
18 3410107 3410400 + NZ_CP045205.1 Citrobacter telavivensis
19 4854554 4854823 - NZ_CP045205.1 Citrobacter telavivensis
20 3589037 3589330 - NZ_LT556085.1 Citrobacter amalonaticus
21 2270010 2270297 + NZ_LT556085.1 Citrobacter amalonaticus
22 1431911 1432204 - NC_003197.2 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
23 91795 92031 + NC_003197.2 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
24 3141031 3141324 + NZ_CP015113.1 Kosakonia radicincitans
25 3094519 3094812 - NZ_CP011254.1 Serratia fonticola
26 226027 226320 + NZ_CP014137.1 Brenneria goodwinii
27 34524 34808 - NZ_CP014137.1 Brenneria goodwinii
28 1604746 1605039 + NC_012880.1 Musicola paradisiaca Ech703
29 914978 915271 + NZ_CP025799.1 Dickeya zeae
30 4909375 4909662 + NC_009901.1 Shewanella pealeana ATCC 700345
31 261162 261449 - NC_010334.1 Shewanella halifaxensis HAW-EB4
32 3925914 3926201 + NC_009831.1 Shewanella sediminis HAW-EB3
33 3173209 3173466 + NC_009092.1 Shewanella loihica PV-4
34 5170156 5170419 + NC_011566.1 Shewanella piezotolerans WP3
35 4165754 4166041 + NZ_CP034015.1 Shewanella livingstonensis
36 438673 438924 + NZ_CP046378.1 Shewanella algae
37 434131 434367 - NZ_CP011602.1 Phytobacter ursingii
38 3814618 3814854 - NZ_CP011602.1 Phytobacter ursingii
39 1737230 1737466 - NZ_CP051548.1 Phytobacter diazotrophicus
40 5088654 5088890 - NZ_CP051548.1 Phytobacter diazotrophicus
41 2649300 2649536 + NZ_LS483470.1 Leminorella richardii
42 2622527 2622763 + NZ_CP029185.2 Limnobaculum parvum
43 2818208 2818444 + NZ_CP034752.1 Jinshanibacter zhutongyuii
44 2735225 2735512 + NZ_CP031218.1 Malaciobacter halophilus
45 4023701 4023964 + NZ_CP050150.1 Hafnia alvei
46 2832908 2833195 + NZ_CP032101.1 Malaciobacter marinus
47 3402778 3403062 - NZ_CP047349.1 Proteus terrae subsp. cibarius
48 3416879 3417166 - NZ_CP047349.1 Proteus terrae subsp. cibarius
49 734184 734471 + NZ_CP006664.1 Edwardsiella anguillarum ET080813
50 56749 57018 + NC_013716.1 Citrobacter rodentium ICC168
51 2854252 2854539 + NC_012779.2 Edwardsiella ictaluri 93-146
52 3107860 3108096 - NC_009792.1 Citrobacter koseri ATCC BAA-895
53 1003380 1003664 - NZ_CP026364.1 Proteus hauseri
54 1017654 1017911 - NZ_CP026364.1 Proteus hauseri
55 2677250 2677486 + NZ_CP053416.1 Salmonella bongori
56 902395 902670 - NZ_CP016043.1 Edwardsiella hoshinae
57 2600299 2600586 - NZ_CP023706.1 Edwardsiella tarda
58 47320 47631 + NZ_CP040882.1 Sutterella faecalis
59 782741 782977 + NZ_CP068055.1 Sutterella wadsworthensis
60 670157 670426 + NZ_LR134340.1 Escherichia marmotae
61 45031 45318 + NZ_CP029736.1 Providencia rettgeri
62 970528 970815 + NC_018017.1 Desulfitobacterium dehalogenans ATCC 51507
63 158480 158767 - NZ_CP031123.2 Providencia huaxiensis
64 3587547 3587816 + NZ_CP057657.1 Escherichia fergusonii
65 1123929 1124216 + NC_011830.1 Desulfitobacterium hafniense DCB-2
66 352588 352827 + NC_011830.1 Desulfitobacterium hafniense DCB-2
67 2142419 2142655 + NZ_CP012871.1 [Enterobacter] lignolyticus
68 839743 840012 - NZ_LS483422.1 Providencia heimbachae
69 3415067 3415303 - NC_017910.1 Shimwellia blattae DSM 4481 = NBRC 105725
70 2898550 2898807 - NC_010554.1 Proteus mirabilis HI4320
71 2169108 2169344 + NC_013204.1 Eggerthella lenta DSM 2243
72 2141679 2141915 - NC_013204.1 Eggerthella lenta DSM 2243
73 3613575 3613811 + NC_013204.1 Eggerthella lenta DSM 2243
74 376860 377123 + NZ_CP012547.1 Campylobacter pinnipediorum subsp. pinnipediorum
75 1945364 1945645 - NZ_CP012543.1 Campylobacter rectus
76 1571886 1572137 - NZ_CP009302.1 Berryella intestinalis
77 617612 617896 + NC_009253.1 Desulfotomaculum reducens MI-1
78 2217478 2217765 + NZ_CP022121.1 Dehalobacterium formicoaceticum
79 955240 955515 + NZ_LR134379.1 Slackia heliotrinireducens
80 2969219 2969467 + NZ_LR134379.1 Slackia heliotrinireducens
81 1005274 1005582 - NC_013170.1 Cryptobacterium curtum DSM 15641
82 1434240 1434476 - NZ_CP007044.2 Chania multitudinisentens RB-25
83 128879 129157 + NZ_LR778174.1 Veillonella parvula
84 652324 652578 - NZ_CP007032.1 Desulfitobacterium metallireducens DSM 15288
85 649463 649744 + NZ_CP007032.1 Desulfitobacterium metallireducens DSM 15288
86 142088 142360 + NZ_LT906470.1 Veillonella rodentium
87 2782612 2782884 - NC_022567.1 Adlercreutzia equolifaciens DSM 19450
88 1109972 1110220 + NZ_CP011402.1 Denitrobacterium detoxificans
89 439554 439844 + NZ_CP036259.1 Sporomusa termitida
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_000913.3
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF01012.23 0.94 62 2265.0 same-strand Electron transfer flavoprotein domain
2 PF00766.21 0.94 62 1352 same-strand Electron transfer flavoprotein FAD-binding domain
3 PF00441.26 0.8 53 5041.0 opposite-strand Acyl-CoA dehydrogenase, C-terminal domain
4 PF02770.21 0.8 53 5057 opposite-strand Acyl-CoA dehydrogenase, middle domain
5 PF08028.13 0.8 53 5041.0 opposite-strand Acyl-CoA dehydrogenase, C-terminal domain
6 PF02771.18 0.8 53 5059.5 opposite-strand Acyl-CoA dehydrogenase, N-terminal domain
7 PF02028.19 0.64 42 3664 opposite-strand BCCT, betaine/carnitine/choline family transporter
8 PF00083.26 0.64 42 111 same-strand Sugar (and other) transporter
++ More..