Protein Information |
Information Type | Description |
---|---|
Protein name | Protein YzgL |
NCBI Accession ID | U00096.3 |
Organism | Escherichia coli (strain K12) |
Left | 3563724 |
Right | 3564005 |
Strand | - |
Nucleotide Sequence | ATGCAAAACAGAAAATGGATTTTGACCTCGCTGGTAATGACTTTTTTCGGCATCCCCATACTGGCGCAATTTTTGGCGGTGGTTATTGCCATGCTGGGTGTCGGACTTGCCGGTATTATTGAAGTTTGTAATATCCTTATCACGCCAACAATTTACCTTCTGCTCAAAATTTTTATGCTGGCGCTGGGCGCATTAATGCTATTTTTCTCGGGGCGAGTGGGGAACGTGCCTGAGTTTTGTTACGTTGGGTATGATGGCGTGGGCTTTGCGGTAATTCCCTGA |
Sequence | MQNRKWILTSLVMTFFGIPILAQFLAVVIAMLGVGLAGIIEVCNILITPTIYLLLKIFMLALGALMLFFSGRVGNVPEFCYVGYDGVGFAVIP |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9278503 16738553 |
Domain | |
Functional Category | Others |
Uniprot ID | P76692 |
ORF Length (Amino Acid) | 93 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3563724 | 3564005 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 3534935 | 3535216 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06956.13 | 1.0 | 2 | 3858.5 | opposite-strand | Regulator of RNA terminal phosphate cyclase |
2 | PF00158.28 | 1.0 | 2 | 3858.5 | opposite-strand | Sigma-54 interaction domain |
3 | PF14532.8 | 1.0 | 2 | 3858.5 | opposite-strand | Sigma-54 interaction domain |
4 | PF07728.16 | 1.0 | 2 | 3858.5 | opposite-strand | AAA domain (dynein-related subfamily) |
5 | PF00455.24 | 1.0 | 2 | 3244.5 | same-strand | DeoR C terminal sensor domain |
6 | PF01694.24 | 1.0 | 2 | 2272.0 | same-strand | Rhomboid family |
7 | PF12122.10 | 1.0 | 2 | 2272.0 | same-strand | Cytoplasmic N-terminal domain of rhomboid serine protease |
8 | PF00581.22 | 1.0 | 2 | 1901.0 | same-strand | Rhodanese-like domain |
9 | PF01266.26 | 1.0 | 2 | 206.0 | opposite-strand | FAD dependent oxidoreductase |
10 | PF16901.7 | 1.0 | 2 | 206.0 | opposite-strand | C-terminal domain of alpha-glycerophosphate oxidase |
11 | PF00343.22 | 1.0 | 2 | 847.5 | same-strand | Carbohydrate phosphorylase |
12 | PF08323.13 | 1.0 | 2 | 3313.5 | same-strand | Starch synthase catalytic domain |
13 | PF00534.22 | 1.0 | 2 | 3313.5 | same-strand | Glycosyl transferases group 1 |
14 | PF00483.25 | 1.0 | 2 | 4746.5 | same-strand | Nucleotidyl transferase |
15 | PF18390.3 | 1.0 | 2 | 6059.5 | same-strand | Glycogen debranching enzyme C-terminal domain |
16 | PF02922.20 | 1.0 | 2 | 6778 | same-strand | Carbohydrate-binding module 48 (Isoamylase N-terminal domain) |