Result : P76692

Protein Information

• Protein name: Protein YzgL
• NCBI Accession ID: U00096.3
• Organism: Escherichia coli (strain K12)
• Left: 3563724
• Right: 3564005
• Strand: -
• Nucleotide Sequence: ATGCAAAACAGAAAATGGATTTTGACCTCGCTGGTAATGACTTTTTTCGGCATCCCCATACTGGCGCAATTTTTGGCGGTGGTTATTGCCATGCTGGGTGTCGGACTTGCCGGTATTATTGAAGTTTGTAATATCCTTATCACGCCAACAATTTACCTTCTGCTCAAAATTTTTATGCTGGCGCTGGGCGCATTAATGCTATTTTTCTCGGGGCGAGTGGGGAACGTGCCTGAGTTTTGTTACGTTGGGTATGATGGCGTGGGCTTTGCGGTAATTCCCTGA
• Sequence: MQNRKWILTSLVMTFFGIPILAQFLAVVIAMLGVGLAGIIEVCNILITPTIYLLLKIFMLALGALMLFFSGRVGNVPEFCYVGYDGVGFAVIP
• Source of smORF: Swiss-Prot
• Pubmed ID: 9278503 16738553
• Functional Category: Others
• Uniprot ID: P76692
• ORF Length (Amino Acid): 93

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	3563724	3564005	-	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
2	3534935	3535216	-	NC_004337.2	Shigella flexneri 2a str. 301

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000913.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF06956.13	1.0	2	3858.5	opposite-strand	Regulator of RNA terminal phosphate cyclase
2	PF00158.28	1.0	2	3858.5	opposite-strand	Sigma-54 interaction domain
3	PF14532.8	1.0	2	3858.5	opposite-strand	Sigma-54 interaction domain
4	PF07728.16	1.0	2	3858.5	opposite-strand	AAA domain (dynein-related subfamily)
5	PF00455.24	1.0	2	3244.5	same-strand	DeoR C terminal sensor domain
6	PF01694.24	1.0	2	2272.0	same-strand	Rhomboid family
7	PF12122.10	1.0	2	2272.0	same-strand	Cytoplasmic N-terminal domain of rhomboid serine protease
8	PF00581.22	1.0	2	1901.0	same-strand	Rhodanese-like domain
9	PF01266.26	1.0	2	206.0	opposite-strand	FAD dependent oxidoreductase
10	PF16901.7	1.0	2	206.0	opposite-strand	C-terminal domain of alpha-glycerophosphate oxidase
11	PF00343.22	1.0	2	847.5	same-strand	Carbohydrate phosphorylase
12	PF08323.13	1.0	2	3313.5	same-strand	Starch synthase catalytic domain
13	PF00534.22	1.0	2	3313.5	same-strand	Glycosyl transferases group 1
14	PF00483.25	1.0	2	4746.5	same-strand	Nucleotidyl transferase
15	PF18390.3	1.0	2	6059.5	same-strand	Glycogen debranching enzyme C-terminal domain
16	PF02922.20	1.0	2	6778	same-strand	Carbohydrate-binding module 48 (Isoamylase N-terminal domain)