Result : P76575
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YfgJ |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 2635599 |
| Right | 2635814 |
| Strand | - |
| Nucleotide Sequence | ATGGAACTGCATTGTCCACAATGTCAGCATGTGCTTGATCAGGATAACGGCCATGCGCGTTGCCGATCCTGCGGGGAATTTATTGAAATGAAAGCTCTTTGTCCAGACTGCCATCAACCGTTGCAGGTGTTAAAAGCCTGTGGTGCAGTAGATTACTTCTGTCAGCACGGGCATGGCTTGATATCGAAAAAACGCGTTGAATTCGTGCTGGCTTAA |
| Sequence | MELHCPQCQHVLDQDNGHARCRSCGEFIEMKALCPDCHQPLQVLKACGAVDYFCQHGHGLISKKRVEFVLA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam07191. Profile Description: zinc-ribbons. This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family have 8 highly conserved cysteine residues, which form two zinc ribbon domains. |
| Pubmed ID | 9278503 16738553 |
| Domain | CDD:399876 |
| Functional Category | Others |
| Uniprot ID | P76575 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 113
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2635599 | 2635814 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2625051 | 2625266 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 1108612 | 1108827 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 3351876 | 3352091 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 4192876 | 4193091 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 6 | 1040504 | 1040725 | + | NZ_CP023525.1 | Cedecea neteri |
| 7 | 3162011 | 3162232 | - | NZ_LR134340.1 | Escherichia marmotae |
| 8 | 3765982 | 3766203 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 9 | 3810052 | 3810273 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 10 | 3455397 | 3455618 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 11 | 3475848 | 3476069 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 12 | 3436728 | 3436949 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 13 | 2651147 | 2651368 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 14 | 1001438 | 1001617 | + | NZ_LR134201.1 | Cedecea lapagei |
| 15 | 4428443 | 4428658 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 16 | 1138923 | 1139141 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 17 | 2180486 | 2180701 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 18 | 3210204 | 3210425 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 19 | 2871242 | 2871457 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 20 | 4890092 | 4890313 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 21 | 1370574 | 1370798 | + | NZ_CP050508.1 | Raoultella terrigena |
| 22 | 2580388 | 2580609 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 23 | 611733 | 611954 | - | NZ_CP053416.1 | Salmonella bongori |
| 24 | 1422491 | 1422706 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 25 | 3551542 | 3551757 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 26 | 2598955 | 2599170 | - | NZ_AP014857.1 | Escherichia albertii |
| 27 | 3787955 | 3788170 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 28 | 3386836 | 3387051 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 29 | 270298 | 270513 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 30 | 1273000 | 1273215 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 31 | 2749639 | 2749860 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 32 | 3743374 | 3743589 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 33 | 238111 | 238332 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 34 | 1177531 | 1177752 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 35 | 4470623 | 4470838 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 36 | 3555326 | 3555547 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 37 | 1216120 | 1216335 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 38 | 3947082 | 3947300 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 39 | 3456844 | 3457059 | - | NC_015968.1 | Enterobacter soli |
| 40 | 1941201 | 1941422 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 41 | 1315866 | 1316084 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 42 | 1310785 | 1311003 | + | NZ_CP054254.1 | Klebsiella variicola |
| 43 | 1292147 | 1292368 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 44 | 3149379 | 3149600 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 45 | 3281789 | 3282010 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 46 | 1332725 | 1332943 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 47 | 3178833 | 3179057 | - | NZ_CP061511.1 | Mixta calida |
| 48 | 776267 | 776488 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 49 | 90659 | 90880 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 50 | 1476871 | 1477086 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 51 | 2537671 | 2537895 | - | NZ_CP028271.1 | Mixta intestinalis |
| 52 | 4976854 | 4977081 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 53 | 970383 | 970604 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 54 | 1323734 | 1323955 | + | NZ_CP041247.1 | Raoultella electrica |
| 55 | 1319667 | 1319885 | - | NZ_CP033744.1 | Citrobacter freundii |
| 56 | 4917925 | 4918140 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 57 | 367808 | 368026 | - | NZ_CP026047.1 | Raoultella planticola |
| 58 | 4741422 | 4741637 | + | NZ_CP038469.1 | Citrobacter tructae |
| 59 | 3942870 | 3943091 | - | NZ_LT906479.1 | Serratia ficaria |
| 60 | 1568809 | 1569027 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 61 | 3393427 | 3393648 | - | NZ_CP026377.1 | Mixta gaviniae |
| 62 | 1228645 | 1228863 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 63 | 3227323 | 3227544 | - | NZ_CP016948.1 | Serratia surfactantfaciens |
| 64 | 1073350 | 1073574 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 65 | 4003635 | 4003856 | - | NZ_LR134494.1 | Serratia quinivorans |
| 66 | 4071537 | 4071758 | - | NC_015567.1 | Serratia plymuthica AS9 |
| 67 | 752186 | 752407 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 68 | 1312958 | 1313140 | + | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 69 | 44741 | 44923 | - | NZ_CP007230.1 | Yersinia similis |
| 70 | 1825008 | 1825229 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 71 | 2462726 | 2462947 | + | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 72 | 524660 | 524881 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 73 | 1193597 | 1193818 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 74 | 3452084 | 3452308 | - | NZ_CP046293.1 | Yersinia intermedia |
| 75 | 1616861 | 1617085 | - | NZ_CP009787.1 | Yersinia rohdei |
| 76 | 3935424 | 3935645 | + | NZ_CP014136.1 | Gibbsiella quercinecans |
| 77 | 1084097 | 1084318 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 78 | 1218616 | 1218840 | + | NZ_CP011118.1 | Yersinia enterocolitica |
| 79 | 2444602 | 2444823 | + | NZ_CP023706.1 | Edwardsiella tarda |
| 80 | 1153807 | 1154028 | + | NZ_CP071320.1 | Serratia ureilytica |
| 81 | 3895426 | 3895650 | + | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 82 | 4475618 | 4475842 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 83 | 1241098 | 1241316 | - | NZ_CP011078.1 | Yersinia ruckeri |
| 84 | 3915657 | 3915878 | - | NZ_CP038662.1 | Serratia nematodiphila |
| 85 | 181545 | 181769 | - | NZ_CP011254.1 | Serratia fonticola |
| 86 | 1245294 | 1245518 | + | NZ_CP043727.1 | Yersinia canariae |
| 87 | 3401964 | 3402188 | - | NZ_CP032487.1 | Yersinia hibernica |
| 88 | 203761 | 203985 | - | NZ_CP065640.1 | Serratia rubidaea |
| 89 | 1311426 | 1311656 | + | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 90 | 4769100 | 4769330 | + | NZ_CP067057.1 | Rahnella aceris |
| 91 | 962471 | 962695 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 92 | 2975987 | 2976208 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 93 | 3949805 | 3950038 | - | NZ_CP048784.1 | Serratia liquefaciens |
| 94 | 3045052 | 3045276 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 95 | 2965163 | 2965390 | - | NZ_LR134531.1 | Pragia fontium |
| 96 | 2663446 | 2663658 | + | NZ_CP019706.1 | Pantoea alhagi |
| 97 | 1058137 | 1058346 | + | NZ_CP038853.1 | Pantoea vagans |
| 98 | 3898684 | 3898926 | - | NZ_CP023009.1 | Lonsdalea britannica |
| 99 | 494399 | 494623 | + | NZ_CP014137.1 | Brenneria goodwinii |
| 100 | 1278068 | 1278253 | + | NZ_CP006569.1 | Sodalis praecaptivus |
| 101 | 936173 | 936397 | + | NZ_CP050150.1 | Hafnia alvei |
| 102 | 971148 | 971375 | + | NZ_CP029185.2 | Limnobaculum parvum |
| 103 | 3933584 | 3933817 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 104 | 1151082 | 1151306 | + | NZ_CP040449.1 | Aeromonas simiae |
| 105 | 3194340 | 3194573 | - | NC_012880.1 | Musicola paradisiaca Ech703 |
| 106 | 928115 | 928342 | + | NZ_LS483470.1 | Leminorella richardii |
| 107 | 3514945 | 3515169 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 108 | 4172656 | 4172892 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 109 | 3380758 | 3380982 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 110 | 2762171 | 2762395 | - | NZ_CP015749.1 | Pectobacterium parmentieri |
| 111 | 2328268 | 2328492 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 112 | 2983460 | 2983684 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 113 | 1483269 | 1483493 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 114 | 2803362 | 2803595 | - | NZ_CP034035.1 | Brenneria rubrifaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00958.24 | 0.68 | 77 | 3762.5 | same-strand | GMP synthase C terminal domain |
| 2 | PF00117.30 | 0.68 | 77 | 3762.5 | same-strand | Glutamine amidotransferase class-I |
| 3 | PF00478.27 | 0.79 | 89 | 2959.0 | same-strand | IMP dehydrogenase / GMP reductase domain |
| 4 | PF00571.30 | 0.79 | 89 | 2958.5 | same-strand | CBS domain |
| 5 | PF02601.17 | 0.82 | 93 | 1427.0 | opposite-strand | Exonuclease VII, large subunit |
| 6 | PF13742.8 | 0.77 | 87 | 1427.0 | opposite-strand | OB-fold nucleic acid binding domain |
| 7 | PF01336.27 | 0.82 | 93 | 1427.0 | opposite-strand | OB-fold nucleic acid binding domain |
| 8 | PF01926.25 | 0.95 | 107 | 1074.5 | same-strand | 50S ribosome-binding GTPase |
| 9 | PF02421.20 | 0.95 | 107 | 1074.5 | same-strand | Ferrous iron transport protein B |
| 10 | PF14714.8 | 0.95 | 107 | 1074.5 | same-strand | KH-domain-like of EngA bacterial GTPase enzymes, C-terminal |
| 11 | PF00009.29 | 0.81 | 91 | 1075.0 | same-strand | Elongation factor Tu GTP binding domain |
| 12 | PF13360.8 | 0.93 | 105 | 2731.0 | same-strand | PQQ-like domain |
| 13 | PF01011.23 | 0.94 | 106 | 2711 | same-strand | PQQ enzyme repeat |
| 14 | PF13570.8 | 0.94 | 106 | 2729.0 | same-strand | PQQ-like domain |
| 15 | PF09976.11 | 0.89 | 101 | 3909.5 | same-strand | Tetratricopeptide repeat-like domain |
| 16 | PF13393.8 | 0.73 | 83 | 4506.0 | same-strand | Histidyl-tRNA synthetase |
| 17 | PF00587.27 | 0.73 | 83 | 4506.0 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 18 | PF03129.22 | 0.73 | 82 | 4506 | same-strand | Anticodon binding domain |
++ More..