Result : P76521
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YfdY |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 2495050 |
| Right | 2495292 |
| Strand | - |
| Nucleotide Sequence | ATGATTAATTTATGGATGTTTCTCGCCCTGTGTATTGTCTGCGTAAGCGGCTACATCGGTCAGGTACTGAACGTGGTATCGGCGGTCTCTTCTTTCTTCGGCATGGTGATCCTCGCTGCACTCATTTATTACTTCACCATGTGGTTAACTGGCGGTAATGAACTAGTGACGGGGATATTTATGTTTCTTGCCCCGGCTTGTGGCTTGATGATTCGCTTTATGGTGGGGTATGGCAGGCGGTAG |
| Sequence | MINLWMFLALCIVCVSGYIGQVLNVVSAVSSFFGMVILAALIYYFTMWLTGGNELVTGIFMFLAPACGLMIRFMVGYGRR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10810. Profile Description: Protein of unknown function (DUF2545). This family of proteins with unknown function is restricted to Enterobacteriaceae. The sequence is highly conserved. |
| Pubmed ID | 9278503 16738553 |
| Domain | CDD:371254 |
| Functional Category | Others |
| Uniprot ID | P76521 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2495050 | 2495292 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1235312 | 1235554 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 2498101 | 2498343 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 3223317 | 3223559 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 2469846 | 2470088 | - | NZ_AP014857.1 | Escherichia albertii |
| 6 | 3042048 | 3042290 | - | NZ_LR134340.1 | Escherichia marmotae |
| 7 | 4322364 | 4322606 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 8 | 3261218 | 3261460 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 9 | 2513796 | 2514038 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 10 | 1185935 | 1186177 | - | NZ_CP033744.1 | Citrobacter freundii |
| 11 | 2064834 | 2065076 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 12 | 10056 | 10298 | + | NZ_CP038469.1 | Citrobacter tructae |
| 13 | 482027 | 482269 | - | NZ_CP053416.1 | Salmonella bongori |
| 14 | 4715389 | 4715631 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 15 | 3909671 | 3909913 | + | NZ_CP044098.1 | Citrobacter portucalensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03279.15 | 0.93 | 13 | 404.5 | opposite-strand | Bacterial lipid A biosynthesis acyltransferase |
| 2 | PF00155.23 | 1.0 | 14 | 1797 | same-strand | Aminotransferase class I and II |
| 3 | PF07694.14 | 0.79 | 11 | 3412.5 | opposite-strand | 5TMR of 5TMR-LYT |
| 4 | PF06580.15 | 0.86 | 12 | 3413 | opposite-strand | Histidine kinase |
| 5 | PF02518.28 | 0.93 | 13 | 3402 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 6 | PF01590.28 | 0.64 | 9 | 3412.5 | opposite-strand | GAF domain |
| 7 | PF04397.17 | 0.79 | 11 | 5124.5 | opposite-strand | LytTr DNA-binding domain |
| 8 | PF00072.26 | 0.93 | 13 | 5117.0 | opposite-strand | Response regulator receiver domain |
++ More..