Result : A5WCZ0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CP000713.1 |
| Organism | Psychrobacter sp. (strain PRwf-1) |
| Left | 693851 |
| Right | 694111 |
| Strand | - |
| Nucleotide Sequence | ATGGCACGTGTAACCGTAGAAGACTGCTTACATGCAGTAGACAACCGCTTTGAGCTGGTATTGGTTGCCAGCAAGCGCGCTCATCAACTGGCCAAAGGCGTCTCTGAGCCGTTAGTTGAAGTCAACAATGACAAGCCAACTGTATTGGCGCTGCGTGAAATTGCTGCCGGCCTAGTGACCAAAGATATCCTAAACCAACCGGATCATCATTTTGCGACGAACTCATTAGATTTGGCATTAAGTGGCGGTCAAGGCTTCTAG |
| Sequence | MARVTVEDCLHAVDNRFELVLVASKRAHQLAKGVSEPLVEVNNDKPTVLALREIAAGLVTKDILNQPDHHFATNSLDLALSGGQGF |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | A5WCZ0 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 76
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 942293 | 942553 | + | NZ_CP012678.1 | Psychrobacter urativorans |
| 2 | 2714307 | 2714567 | + | NZ_CP014945.1 | Psychrobacter alimentarius |
| 3 | 2768836 | 2769096 | - | NZ_LR884459.1 | Psychrobacter arenosus |
| 4 | 2124134 | 2124394 | + | NC_007204.1 | Psychrobacter arcticus 273-4 |
| 5 | 2464252 | 2464512 | + | NC_007969.1 | Psychrobacter cryohalolentis K5 |
| 6 | 2304787 | 2305053 | - | NZ_CP014234.1 | Moraxella osloensis |
| 7 | 3161108 | 3161389 | + | NZ_CP049801.1 | Acinetobacter shaoyimingii |
| 8 | 367876 | 368157 | - | NZ_AP014630.1 | Acinetobacter guillouiae |
| 9 | 3091591 | 3091872 | + | NZ_CP029397.2 | Acinetobacter defluvii |
| 10 | 3229226 | 3229507 | + | NC_005966.1 | Acinetobacter baylyi ADP1 |
| 11 | 3302284 | 3302565 | + | NZ_CP016895.1 | Acinetobacter larvae |
| 12 | 329587 | 329868 | - | NZ_CP044483.1 | Acinetobacter schindleri |
| 13 | 3268651 | 3268932 | + | NZ_CP032134.1 | Acinetobacter chinensis |
| 14 | 2443002 | 2443283 | + | NZ_CP045650.1 | Acinetobacter wanghuae |
| 15 | 278857 | 279138 | + | NZ_CP071766.1 | Acinetobacter towneri |
| 16 | 3034914 | 3035195 | + | NZ_CP049916.1 | Acinetobacter lanii |
| 17 | 2832365 | 2832643 | + | NC_016603.1 | Acinetobacter pittii PHEA-2 |
| 18 | 2287768 | 2288046 | - | NZ_CP070518.1 | Acinetobacter calcoaceticus |
| 19 | 345546 | 345824 | - | NZ_CP053391.1 | Acinetobacter lactucae |
| 20 | 352907 | 353185 | - | NC_014259.1 | Acinetobacter oleivorans DR1 |
| 21 | 407666 | 407947 | - | NZ_CP035934.2 | Acinetobacter cumulans |
| 22 | 2375114 | 2375392 | - | NZ_CP040105.1 | Acinetobacter nosocomialis M2 |
| 23 | 340459 | 340737 | - | NZ_CP015121.1 | Acinetobacter baumannii |
| 24 | 374229 | 374507 | - | NZ_CP065820.1 | Acinetobacter seifertii |
| 25 | 3433606 | 3433884 | - | NZ_CP041970.1 | Acinetobacter dispersus |
| 26 | 357602 | 357880 | - | NZ_CP024632.1 | Acinetobacter junii |
| 27 | 296378 | 296656 | - | NZ_CP030880.1 | Acinetobacter haemolyticus |
| 28 | 1156571 | 1156852 | - | NZ_CP012808.1 | Acinetobacter equi |
| 29 | 2929012 | 2929284 | + | NZ_CP031222.1 | Aquirhabdus parva |
| 30 | 80596 | 80868 | + | NZ_LR134343.1 | Moraxella cuniculi |
| 31 | 368130 | 368402 | - | NC_014147.1 | Moraxella catarrhalis BBH18 |
| 32 | 2152282 | 2152542 | + | NZ_CP048711.1 | Kineobactrum salinum |
| 33 | 5282251 | 5282538 | + | NC_003910.7 | Colwellia psychrerythraea 34H |
| 34 | 186855 | 187118 | - | NC_008260.1 | Alcanivorax borkumensis SK2 |
| 35 | 932355 | 932615 | + | NZ_CP065728.1 | Moraxella nonliquefaciens |
| 36 | 1844445 | 1844705 | - | NZ_CP030241.1 | Moraxella bovis |
| 37 | 2801369 | 2801629 | - | NC_018868.3 | Simiduia agarivorans SA1 = DSM 21679 |
| 38 | 294576 | 294788 | + | NC_017506.1 | Marinobacter adhaerens HP15 |
| 39 | 948786 | 949052 | + | NZ_CP014143.1 | Microbulbifer aggregans |
| 40 | 478670 | 478909 | + | NZ_CP048878.1 | Spartinivicinus ruber |
| 41 | 104517 | 104780 | - | NZ_CP047491.1 | Microbulbifer hydrolyticus |
| 42 | 714221 | 714433 | + | NZ_CP043042.1 | Marinobacter fonticola |
| 43 | 4264790 | 4265041 | + | NC_010995.1 | Cellvibrio japonicus Ueda107 |
| 44 | 821339 | 821626 | + | NC_019940.1 | Thioflavicoccus mobilis 8321 |
| 45 | 3420841 | 3421053 | - | NZ_CP043869.1 | Neptunomonas concharum |
| 46 | 2674862 | 2675149 | - | NZ_CP034759.1 | Litorilituus sediminis |
| 47 | 659125 | 659397 | - | NZ_CP072844.1 | Psychrosphaera aestuarii |
| 48 | 4019789 | 4020052 | + | NZ_CP014544.1 | Zhongshania aliphaticivorans |
| 49 | 3633891 | 3634166 | + | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 50 | 3835745 | 3836020 | + | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 51 | 4681213 | 4681485 | + | NC_007912.1 | Saccharophagus degradans 2-40 |
| 52 | 144379 | 144654 | - | NZ_CP017689.1 | Thalassotalea crassostreae |
| 53 | 1863888 | 1864163 | - | NZ_CP019343.1 | Oceanicoccus sagamiensis |
| 54 | 4219513 | 4219737 | + | NZ_CP061941.1 | Marinomonas algicola |
| 55 | 4974148 | 4974360 | - | NZ_CP015839.1 | Marinobacterium aestuarii |
| 56 | 3635114 | 3635416 | - | NC_018012.1 | Thiocystis violascens DSM 198 |
| 57 | 1771193 | 1771462 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 58 | 180979 | 181242 | - | NC_018691.1 | Alcanivorax dieselolei B5 |
| 59 | 3564895 | 3565185 | - | NZ_CP064030.1 | Dyella caseinilytica |
| 60 | 3977631 | 3977855 | + | NZ_CP054301.1 | Marinomonas primoryensis |
| 61 | 1225974 | 1226249 | - | NZ_CP009888.1 | Pseudoalteromonas piratica |
| 62 | 495863 | 496141 | - | NZ_CP011039.1 | Pseudoalteromonas spongiae UST010723-006 |
| 63 | 3339275 | 3339538 | - | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
| 64 | 3815607 | 3815831 | + | NC_015559.1 | Marinomonas posidonica IVIA-Po-181 |
| 65 | 659491 | 659766 | - | NZ_CP011367.1 | Thioalkalivibrio versutus |
| 66 | 3322886 | 3323161 | + | NZ_CP013187.1 | Pseudoalteromonas phenolica |
| 67 | 4441438 | 4441662 | + | NZ_CP061081.1 | Marinomonas arctica |
| 68 | 1902190 | 1902414 | + | NZ_CP070273.1 | Marinomonas foliarum |
| 69 | 188621 | 188890 | - | NZ_CP028926.1 | Pasteurella multocida |
| 70 | 2299812 | 2300021 | - | NZ_CP009788.1 | Geobacter pickeringii |
| 71 | 3439336 | 3439551 | + | NZ_CP072793.1 | Thiothrix unzii |
| 72 | 964743 | 965009 | + | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 73 | 2686650 | 2686889 | + | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 74 | 9616049 | 9616288 | + | NZ_CP016211.1 | Minicystis rosea |
| 75 | 10318436 | 10318675 | - | NZ_CP012159.1 | Chondromyces crocatus |
| 76 | 2617109 | 2617342 | - | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012678.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00625.23 | 0.88 | 67 | 77 | same-strand | Guanylate kinase |
| 2 | PF13328.8 | 0.93 | 71 | 203 | same-strand | HD domain |
| 3 | PF02824.23 | 0.93 | 71 | 203 | same-strand | TGS domain |
| 4 | PF01966.24 | 0.92 | 70 | 203.0 | same-strand | HD domain |
| 5 | PF01042.23 | 0.83 | 63 | 2403 | same-strand | Endoribonuclease L-PSP |
++ More..