Result : P76164
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein YdfW |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1647174 |
| Right | 1647323 |
| Strand | - |
| Nucleotide Sequence | GTGGATAATGCCCGTATTGATTTACGCTCAAAATACTATGTTAAACCTAAAGCTGACCATCCCTGGCTTACGCGCCGAACGCAAAGTCATCAGCAAGTTAAGCCCCCGAAGTTACCTAAAAAGAAGCCTGATCCCGATAAAAAAGATTGA |
| Sequence | MDNARIDLRSKYYVKPKADHPWLTRRTQSHQQVKPPKLPKKKPDPDKKD |
| Source of smORF | Swiss-Prot |
| Function | May be involved in H(2) production during fermentative growth. {ECO:0000269|Pubmed:24025676}. |
| Pubmed ID | 9278503 16738553 24025676 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P76164 |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 70140 | 70289 | - | NZ_CP011600.1 | Phytobacter ursingii |
| 2 | 1647174 | 1647323 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 245082 | 245231 | - | NZ_CP061512.1 | Mixta calida |
| 4 | 30504 | 30653 | - | NZ_CP011601.1 | Phytobacter ursingii |
| 5 | 87556 | 87705 | + | NZ_CP033743.1 | Citrobacter freundii |
| 6 | 142815 | 142967 | - | NZ_CP017185.1 | Enterobacter roggenkampii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04221.14 | 0.8 | 4 | 3901.0 | same-strand | RelB antitoxin |
++ More..