Result : P76157
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YnfN |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1637954 |
| Right | 1638109 |
| Strand | - |
| Nucleotide Sequence | ATGCGTGAATATCCAAATGGCGAAAAAACACACCTTACTGTAATGGCCGCAGGGTTTCCATCTCTGACCGGAGATCATAAAGTCATTTATGTAGCCGCGGATCGACATGTTACTTCAGAAGAAATTCTGGAAGCAGCAATAAGGCTCTTGAGTTGA |
| Sequence | MREYPNGEKTHLTVMAAGFPSLTGDHKVIYVAADRHVTSEEILEAAIRLLS |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9278503 16738553 14527658 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P76157 |
| ORF Length (Amino Acid) | 51 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1637954 | 1638109 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 3997261 | 3997416 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 3 | 605799 | 605954 | - | NZ_CP033744.1 | Citrobacter freundii |
| 4 | 3511435 | 3511590 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 5 | 2485336 | 2485500 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 6 | 2120233 | 2120409 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 7 | 3052867 | 3053043 | + | NZ_CP026047.1 | Raoultella planticola |
| 8 | 4172463 | 4172639 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 9 | 2711128 | 2711301 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 10 | 1061116 | 1061301 | - | NZ_CP035129.1 | Kosakonia cowanii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00313.24 | 0.6 | 6 | 346.5 | same-strand | 'Cold-shock' DNA-binding domain |
++ More..