Result : P76118

Protein Information

• Protein name: Uncharacterized protein YncH
• NCBI Accession ID: U00096.3
• Organism: Escherichia coli (strain K12)
• Left: 1526940
• Right: 1527152
• Strand: +
• Nucleotide Sequence: ATGGTATGTTTTTTAATTTATATCACTCTCCTTTTCATTCAGCGTGTCTATTTCATTTCCTCTGAAAAGAAACTAACTATTCACATCGTGCAGATGTTTCAGTTGTTATCACAGGCATTCTATAATCTCAAAATGTTTTTAATGATGGATATGCTCGGAGTTGGAGATGCAATTAATATTAATACAAATAAAAATATCCGGCAGGTATGCTAA
• Sequence: MVCFLIYITLLFIQRVYFISSEKKLTIHIVQMFQLLSQAFYNLKMFLMMDMLGVGDAININTNKNIRQVC
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of pfam17520. Profile Description: Family of unknown function (DUF5445). This is a family of unknown function found in Enterobacteriaceae.
• Pubmed ID: 9278503 16738553
• Domain: CDD:340235
• Functional Category: Others
• Uniprot ID: P76118
• ORF Length (Amino Acid): 70

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1526940	1527152	+	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
2	1828512	1828724	+	NZ_CP061527.1	Shigella dysenteriae
3	2042842	2043054	+	NC_002695.2	Escherichia coli O157:H7 str. Sakai

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000913.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF07715.17	1.0	2	3875	opposite-strand	TonB-dependent Receptor Plug Domain
2	PF00324.23	1.0	2	960	opposite-strand	Amino acid permease
3	PF13520.8	1.0	2	960	opposite-strand	Amino acid permease