| Protein name |
Uncharacterized protein YnaK |
| NCBI Accession ID |
U00096.3 |
| Organism |
Escherichia coli (strain K12) |
| Left |
1425377 |
| Right |
1425640 |
| Strand |
+ |
| Nucleotide Sequence |
ATGAGCGAGAAATTAAAGATAGTCTATCGCCCATTACAAGAATTGTCACCGTATGCGCACAACGCCAGGACGCACAGTACTGAGCAGGTGGCACAACTGGTAGAAAGTATTAAGCAATTCGGCTGGACTAATCCGGTGCTGATTGACGAAAAGGGCGAAATTATTGCGGGTCACGGTCGTGTTATGGCGGCTGAAATGCTCAAAATGGATTCTGTTCCGGTCATTGTTCTGTCTGGCCTGACGGATGAGCAGAAGCAGCGATAA |
| Sequence |
MSEKLKIVYRPLQELSPYAHNARTHSTEQVAQLVESIKQFGWTNPVLIDEKGEIIAGHGRVMAAEMLKMDSVPVIVLSGLTDEQKQR |
| Source of smORF |
Swiss-Prot |
| Function |
The ORF matches to the profile of cl02129. Profile Description: ParB-like nuclease domain. This domain is probably distantly related to pfam02195. Suggesting these uncharacterized proteins have a nuclease function.**The ORF matches to the profile of cl28891. Profile Description: ParB N-terminal domain and sulfiredoxin protein-related families. This is family of bacterial proteins likely to be necessary for binding to DNA and recognising the modification sites. Members are found in bacteria, archaea and on viral plasmids, and are typically between 354 and 474 amino acids in length. There is a conserved DGQHR sequence motif. |
| Pubmed ID |
9278503
16738553
|
| Domain |
CDD:413208,CDD:421688 |
| Functional Category |
Others |
| Uniprot ID |
P76068
|
| ORF Length (Amino Acid) |
87 |