Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YdaG |
NCBI Accession ID | U00096.3 |
Organism | Escherichia coli (strain K12) |
Left | 1419322 |
Right | 1419456 |
Strand | - |
Nucleotide Sequence | ATGGTGCATTACGAAGTAGTTCAGTATTTGATGGATTGTTGCGGTATCACTTACAACCAGGCTGTGCAGGCTTTACGCAGCAACGACTGGGATCTCTGGCAGGCAGAAGTCGCTATACGTAGCAACAAGATGTGA |
Sequence | MVHYEVVQYLMDCCGITYNQAVQALRSNDWDLWQAEVAIRSNKM |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 9278503 16738553 19121005 |
Domain | |
Functional Category | Others |
Uniprot ID | P76061 |
ORF Length (Amino Acid) | 44 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1928930 | 1929064 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
2 | 1419322 | 1419456 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
3 | 2338580 | 2338714 | + | NZ_LR134340.1 | Escherichia marmotae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF14163.8 | 1.0 | 2 | 163 | opposite-strand | Super-infection exclusion protein B |
2 | PF07151.14 | 1.0 | 2 | 11 | same-strand | Protein of unknown function (DUF1391) |
3 | PF01381.24 | 1.0 | 2 | 287.5 | same-strand | Helix-turn-helix |
4 | PF13560.8 | 1.0 | 2 | 287.5 | same-strand | Helix-turn-helix domain |