Result : P76061
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YdaG |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1419322 |
| Right | 1419456 |
| Strand | - |
| Nucleotide Sequence | ATGGTGCATTACGAAGTAGTTCAGTATTTGATGGATTGTTGCGGTATCACTTACAACCAGGCTGTGCAGGCTTTACGCAGCAACGACTGGGATCTCTGGCAGGCAGAAGTCGCTATACGTAGCAACAAGATGTGA |
| Sequence | MVHYEVVQYLMDCCGITYNQAVQALRSNDWDLWQAEVAIRSNKM |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9278503 16738553 19121005 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P76061 |
| ORF Length (Amino Acid) | 44 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1928930 | 1929064 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1419322 | 1419456 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 2338580 | 2338714 | + | NZ_LR134340.1 | Escherichia marmotae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14163.8 | 1.0 | 2 | 163 | opposite-strand | Super-infection exclusion protein B |
| 2 | PF07151.14 | 1.0 | 2 | 11 | same-strand | Protein of unknown function (DUF1391) |
| 3 | PF01381.24 | 1.0 | 2 | 287.5 | same-strand | Helix-turn-helix |
| 4 | PF13560.8 | 1.0 | 2 | 287.5 | same-strand | Helix-turn-helix domain |
++ More..