Result : P76057
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YdaQ |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1413237 |
| Right | 1413452 |
| Strand | - |
| Nucleotide Sequence | ATGGCACAAGTAATCTTTAATGAAGAGTGGATGGTTGAATACGGCCTGATGCTTCGCACTGGTCTGGGGGCCAGACAAATTGAAGCATACCGCCAGAACTGTTGGGTGGAGGGCTTCCACTTCAAACGAGTATCTCCTTTAGGTAAGCCAGACAGCAAACGAGGGATTATCTGGTACAACTATCCAAAGATAAATCAGTTTATCAAAGACTCATGA |
| Sequence | MAQVIFNEEWMVEYGLMLRTGLGARQIEAYRQNCWVEGFHFKRVSPLGKPDSKRGIIWYNYPKINQFIKDS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam06806. Profile Description: Putative excisionase (DUF1233). This family consists of several putative phage excisionase proteins of around 80 residues in length. |
| Pubmed ID | 9278503 16738553 |
| Domain | CDD:399649 |
| Functional Category | Others |
| Uniprot ID | P76057 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2344584 | 2344799 | + | NZ_LR134340.1 | Escherichia marmotae |
| 2 | 1413237 | 1413452 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1922846 | 1923061 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 2887226 | 2887438 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 5 | 3313141 | 3313356 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 6 | 1795251 | 1795466 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 7 | 2523609 | 2523821 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 8 | 4759070 | 4759282 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 9 | 309484 | 309696 | + | NZ_CP033744.1 | Citrobacter freundii |
| 10 | 1340870 | 1341082 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 11 | 3583600 | 3583815 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 12 | 1572829 | 1573044 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 13 | 4044711 | 4044926 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 14 | 4363847 | 4364065 | + | NC_015567.1 | Serratia plymuthica AS9 |
| 15 | 2161802 | 2162014 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 16 | 2685616 | 2685834 | + | NZ_LT615367.1 | Dickeya aquatica |
| 17 | 2684665 | 2684883 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134340.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03837.16 | 0.69 | 11 | 346.0 | same-strand | RecT family |
| 2 | PF12167.10 | 0.94 | 15 | 2.0 | same-strand | Arm DNA-binding domain |
| 3 | PF00589.24 | 0.88 | 14 | 2 | same-strand | Phage integrase family |
| 4 | PF01171.22 | 0.62 | 10 | 1290 | same-strand | PP-loop family |
| 5 | PF01544.20 | 0.62 | 10 | 4129 | opposite-strand | CorA-like Mg2+ transporter protein |
++ More..