Result : P75991
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable two-component-system connector protein YcgZ |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1215789 |
| Right | 1216025 |
| Strand | + |
| Nucleotide Sequence | ATGCATCAAAATTCAGTGACTTTAGATTCTGCGGGAGCAATCACTCGTTACTTTGCAAAAGCTAACTTGCATACTCAGCAGGAAACTCTCGGGGAAATTGTGACTGAGATTTTGAAAGATGGACGTAATCTGAGTCGAAAGTCGCTTTGTGCCAAACTTCTTTGCCGACTGGAACACGCGACTGGGGAAGAGGAACAGAAACATTATAATGCACTAATTGGGTTGCTTTTTGAATAA |
| Sequence | MHQNSVTLDSAGAITRYFAKANLHTQQETLGEIVTEILKDGRNLSRKSLCAKLLCRLEHATGEEEQKHYNALIGLLFE |
| Source of smORF | Swiss-Prot |
| Function | Probably a connector protein for RcsB/C regulation of biofilm formation, providing additional signal input into the two-component signaling pathway. Partially antagonizes the activities of YmgA and AriR, proteins that, via the Rcs phosphorelay, promote the synthesis of colanic acid, an exopolysaccharide and matrix component. |
| Pubmed ID | 9278503 16738553 14527658 18174134 19172264 19240136 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P75991 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 53
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1215789 | 1216025 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 4592512 | 4592748 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 3 | 499907 | 500143 | - | NZ_CP033744.1 | Citrobacter freundii |
| 4 | 2144638 | 2144874 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 5 | 2135080 | 2135319 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 6 | 3499794 | 3500033 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 7 | 2051610 | 2051849 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 8 | 1968666 | 1968905 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 9 | 1496126 | 1496365 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 10 | 1228510 | 1228749 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 11 | 577681 | 577920 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 12 | 834993 | 835232 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 13 | 1894643 | 1894882 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 14 | 1973654 | 1973893 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 15 | 1948093 | 1948332 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 16 | 1920823 | 1921062 | - | NC_015968.1 | Enterobacter soli |
| 17 | 2184517 | 2184756 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 18 | 1178631 | 1178870 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 19 | 2723336 | 2723575 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 20 | 4064976 | 4065215 | - | NZ_CP047495.1 | Pectobacterium brasiliense |
| 21 | 4957485 | 4957727 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 22 | 780400 | 780642 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 23 | 2103222 | 2103461 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 24 | 1634895 | 1635134 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 25 | 183498 | 183737 | - | NZ_CP012267.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 26 | 395263 | 395502 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 27 | 1011976 | 1012230 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 28 | 25926 | 26165 | - | NZ_CP049260.1 | Cronobacter sakazakii |
| 29 | 64392 | 64631 | - | NZ_CP013941.1 | Cronobacter malonaticus LMG 23826 |
| 30 | 1003 | 1242 | + | NZ_CP012258.1 | Cronobacter universalis NCTC 9529 |
| 31 | 67276 | 67515 | - | NZ_CP012265.1 | Cronobacter condimenti 1330 |
| 32 | 3721481 | 3721720 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 33 | 4055235 | 4055480 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 34 | 4429677 | 4429916 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 35 | 199737 | 199976 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 36 | 1487952 | 1488191 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 37 | 4221171 | 4221413 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 38 | 3646146 | 3646391 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 39 | 3608380 | 3608625 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 40 | 1668495 | 1668740 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 41 | 3830164 | 3830409 | + | NZ_CP054254.1 | Klebsiella variicola |
| 42 | 2603108 | 2603353 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 43 | 3089195 | 3089440 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 44 | 1634070 | 1634309 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 45 | 2257087 | 2257326 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 46 | 3052166 | 3052405 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 47 | 12517 | 12762 | - | NC_017553.1 | Pantoea ananatis PA13 |
| 48 | 45005 | 45253 | + | NC_014305.1 | Erwinia billingiae Eb661 |
| 49 | 2741957 | 2742205 | + | NZ_LR134201.1 | Cedecea lapagei |
| 50 | 2216355 | 2216594 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 51 | 159578 | 159823 | + | NZ_CP049116.1 | Pantoea stewartii |
| 52 | 2984921 | 2985169 | + | NZ_CP023525.1 | Cedecea neteri |
| 53 | 1725403 | 1725624 | - | NZ_CP023567.1 | Erwinia pyrifoliae |
| 54 | 2172294 | 2172539 | + | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 55 | 129543 | 129788 | + | NZ_LN907828.1 | Erwinia gerundensis |
| 56 | 4532564 | 4532815 | + | NZ_CP049115.1 | Pantoea stewartii |
| 57 | 221811 | 222050 | - | NZ_CP049115.1 | Pantoea stewartii |
| 58 | 1630747 | 1630992 | - | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 59 | 1803732 | 1803977 | - | NZ_CP028271.1 | Mixta intestinalis |
| 60 | 2213555 | 2213794 | + | NZ_CP038853.1 | Pantoea vagans |
| 61 | 2540661 | 2540900 | + | NC_017554.1 | Pantoea ananatis PA13 |
| 62 | 467152 | 467379 | + | NZ_CP038854.1 | Pantoea vagans |
| 63 | 129859 | 130104 | + | NZ_CP045721.1 | Pantoea eucalypti |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13411.8 | 0.77 | 41 | 1738 | opposite-strand | MerR HTH family regulatory protein |
| 2 | PF00376.25 | 0.79 | 42 | 1739.5 | opposite-strand | MerR family regulatory protein |
| 3 | PF12728.9 | 0.66 | 35 | 1748 | opposite-strand | Helix-turn-helix domain |
| 4 | PF00563.22 | 0.77 | 41 | 340.0 | opposite-strand | EAL domain |
| 5 | PF04940.14 | 0.83 | 44 | 339.0 | opposite-strand | Sensors of blue-light using FAD |
| 6 | PF10798.10 | 0.94 | 50 | 481.0 | same-strand | Biofilm development protein YmgB/AriR |
++ More..