Result : P75979
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YmfR |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1205549 |
| Right | 1205731 |
| Strand | + |
| Nucleotide Sequence | ATGATCATGCTGATTCTCGCGCCTCTGGTGGGCGTGCTGGGTGCGCTTTTGCTGGCGTATGGTGCCTGGCTGATTTATCCCCCGGCGGGTTTTGTTGTTGCCGGGGCGCTGTGCCTGTTCTGGTCGTGGCTGGTGGCGCGATATCTCGACCGTACACAGTCGTCTGTCGGCGGAGGTAAATAG |
| Sequence | MIMLILAPLVGVLGALLLAYGAWLIYPPAGFVVAGALCLFWSWLVARYLDRTQSSVGGGK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 8905232 9278503 16738553 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P75979 |
| ORF Length (Amino Acid) | 60 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1205549 | 1205731 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 5101380 | 5101565 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 3 | 3269744 | 3269929 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 4 | 3301764 | 3301946 | - | NC_015968.1 | Enterobacter soli |
| 5 | 5344789 | 5344974 | + | NZ_CP014137.1 | Brenneria goodwinii |
| 6 | 1253759 | 1253923 | + | NC_013892.1 | Xenorhabdus bovienii SS-2004 |
| 7 | 974759 | 974923 | + | NZ_CP072455.1 | Xenorhabdus budapestensis |
| 8 | 4418081 | 4418242 | + | NZ_CP016176.1 | Xenorhabdus hominickii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT556085.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05135.15 | 0.71 | 5 | 3375.0 | same-strand | Phage gp6-like head-tail connector protein |
| 2 | PF05065.15 | 0.86 | 6 | 1883 | same-strand | Phage capsid family |
| 3 | PF04586.19 | 0.86 | 6 | 1216 | same-strand | Caudovirus prohead serine protease |
| 4 | PF04860.14 | 0.86 | 6 | 0 | same-strand | Phage portal protein |
| 5 | PF03354.17 | 0.86 | 6 | 22 | same-strand | Phage Terminase |
| 6 | PF05119.14 | 0.86 | 6 | 1749 | same-strand | Phage terminase, small subunit |
++ More..