Result : P75975
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Prophage transcriptional regulatory protein (Putative lambdoid prophage e14 transcriptional regulatory protein) |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1203024 |
| Right | 1203224 |
| Strand | + |
| Nucleotide Sequence | ATGAAAGCGTATTGGGACTCTTTAACCAAAGAACAGCAGGGCGAGTTGGCCGGAAAAGTTGGCTCAACACCTGGCTACTTACGGCTGGTTTTCAATGGCTATAAAAAAGCCAGTTTTGTGCTGGCTAAAAAACTTGAGCAATACACATCAGGTGCAATTACGAAATCTGACTTAAGACCGGATATCTATCCGAAAGATTAG |
| Sequence | MKAYWDSLTKEQQGELAGKVGSTPGYLRLVFNGYKKASFVLAKKLEQYTSGAITKSDLRPDIYPKD |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
| Pubmed ID | 9278503 16738553 |
| Domain | CDD:419869 |
| Functional Category | Others |
| Uniprot ID | P75975 |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1203024 | 1203224 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 700696 | 700896 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 3 | 1320260 | 1320481 | - | NZ_CP049115.1 | Pantoea stewartii |
| 4 | 3486913 | 3487143 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 5 | 1654850 | 1655080 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 6 | 822066 | 822269 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 7 | 3180059 | 3180256 | - | NZ_CP046293.1 | Yersinia intermedia |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00717.25 | 1.0 | 7 | 68 | opposite-strand | Peptidase S24-like |
| 2 | PF13730.8 | 0.71 | 5 | 929 | same-strand | Helix-turn-helix domain |
++ More..