Protein Information |
Information Type | Description |
---|---|
Protein name | Prophage transcriptional regulatory protein (Putative lambdoid prophage e14 transcriptional regulatory protein) |
NCBI Accession ID | U00096.3 |
Organism | Escherichia coli (strain K12) |
Left | 1203024 |
Right | 1203224 |
Strand | + |
Nucleotide Sequence | ATGAAAGCGTATTGGGACTCTTTAACCAAAGAACAGCAGGGCGAGTTGGCCGGAAAAGTTGGCTCAACACCTGGCTACTTACGGCTGGTTTTCAATGGCTATAAAAAAGCCAGTTTTGTGCTGGCTAAAAAACTTGAGCAATACACATCAGGTGCAATTACGAAATCTGACTTAAGACCGGATATCTATCCGAAAGATTAG |
Sequence | MKAYWDSLTKEQQGELAGKVGSTPGYLRLVFNGYKKASFVLAKKLEQYTSGAITKSDLRPDIYPKD |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl22854. Profile Description: N/A. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254. |
Pubmed ID | 9278503 16738553 |
Domain | CDD:419869 |
Functional Category | Others |
Uniprot ID | P75975 |
ORF Length (Amino Acid) | 66 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1203024 | 1203224 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 700696 | 700896 | - | NZ_CP042941.1 | Atlantibacter hermannii |
3 | 1320260 | 1320481 | - | NZ_CP049115.1 | Pantoea stewartii |
4 | 3486913 | 3487143 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
5 | 1654850 | 1655080 | - | NZ_CP027107.1 | Cronobacter sakazakii |
6 | 822066 | 822269 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
7 | 3180059 | 3180256 | - | NZ_CP046293.1 | Yersinia intermedia |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00717.25 | 1.0 | 7 | 68 | opposite-strand | Peptidase S24-like |
2 | PF13730.8 | 0.71 | 5 | 929 | same-strand | Helix-turn-helix domain |