Result : P75970
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Prophage excisionase-like protein (Excisionase-like protein from lambdoid prophage 14) |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 1200787 |
| Right | 1201032 |
| Strand | - |
| Nucleotide Sequence | ATGCTTCAAATGTTAACTCTTGAAGAATGGGCTGCTGAAAAATACAGAAGTAATCCTCCAAGTGTGTCCACATTGCGTCGTTATGCTAAGCAGAATTTATTTTGTCCACCGGCCATGAAACAAGGCCGGTTATGGCGAGTGCGTGAGGACGCCGAGTTAGTTGGGGAGTTGGTAACACCTGTAATCAAGAAAAATGACTCATTACTTTTGCAACGGATTTTGAGTAATGGCAGCCAGACCGCGTAA |
| Sequence | MLQMLTLEEWAAEKYRSNPPSVSTLRRYAKQNLFCPPAMKQGRLWRVREDAELVGELVTPVIKKNDSLLLQRILSNGSQTA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam07825. Profile Description: Excisionase-like protein. The phage-encoded excisionase protein (Xis) is involved in excisive recombination by regulating the assembly of the excisive intasome and by inhibiting viral integration. It adopts an unusual 'winged'-helix structure in which two alpha helices are packed against two extended strands. Also present in the structure is a two-stranded anti-parallel beta-sheet, whose strands are connected by a four-residue 'wing'. During interaction with DNA, helix alpha2 is thought to insert into the major groove, while the wing contacts the adjacent minor groove or phosphodiester backbone. The C-terminal region of Xis is involved in interaction with phage-encoded integrase (Int), and a putative C-terminal alpha helix may fold upon interaction with Int and/or DNA. |
| Pubmed ID | 8905232 9278503 16738553 |
| Domain | CDD:116439 |
| Functional Category | DNA-binding |
| Uniprot ID | P75970 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1200787 | 1201032 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2950810 | 2951055 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 3 | 3167232 | 3167477 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 4 | 3406622 | 3406867 | + | NZ_CP054254.1 | Klebsiella variicola |
| 5 | 1659070 | 1659315 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 6 | 2293439 | 2293684 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 7 | 1014366 | 1014611 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 8 | 1659488 | 1659733 | - | NZ_CP023567.1 | Erwinia pyrifoliae |
| 9 | 2204136 | 2204381 | - | NZ_LR134494.1 | Serratia quinivorans |
| 10 | 1349930 | 1350166 | - | NZ_FO704551.1 | Xenorhabdus poinarii G6 |
| 11 | 2798410 | 2798637 | - | NZ_CP023536.1 | Providencia alcalifaciens |
| 12 | 1030446 | 1030688 | - | NC_010554.1 | Proteus mirabilis HI4320 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00180.22 | 0.75 | 9 | 1226 | opposite-strand | Isocitrate/isopropylmalate dehydrogenase |
| 2 | PF09003.12 | 1.0 | 12 | -19.0 | same-strand | Bacteriophage lambda integrase, Arm DNA-binding domain |
| 3 | PF00589.24 | 1.0 | 12 | -19.0 | same-strand | Phage integrase family |
++ More..