Result : P75718

Protein Information

• Protein name: Putative protein RenD (Putative defective protein Ren from DLP12 prophage)
• NCBI Accession ID: U82598.1
• Organism: Escherichia coli (strain K12)
• Left: 8693
• Right: 8878
• Strand: +
• Nucleotide Sequence: ATGGCGCGGGCAGGAATCCTGGTCGTTGATGGTAAGGTCTGGCGAACGGTGTATTACCGGTTCGCTACCAGAGAAGAATGGGAAGGAAAGGTGAGCACGAATCTGATTTTTAAGGAGTGTCGCCAGAGTGCCGCGATGAAACGGGTATTGAGGGTATATAAAAGAACATCAATGGGAACACAATGA
• Sequence: MARAGILVVDGKVWRTVYYRFATREEWEGKVSTNLIFKECRQSAAMKRVLRVYKRTSMGTQ
• Source of smORF: Swiss-Prot
• Pubmed ID: 9278503 16738553
• Functional Category: Others
• Uniprot ID: P75718
• ORF Length (Amino Acid): 61

Conservation Analysis

No. of Species: 7

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	568062	568247	+	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
2	1847980	1848165	+	NZ_LR134340.1	Escherichia marmotae
3	1621458	1621643	+	NC_002695.2	Escherichia coli O157:H7 str. Sakai
4	2930191	2930364	-	NC_002695.2	Escherichia coli O157:H7 str. Sakai
5	31138	31311	+	NZ_CP068597.1	Paenibacillus sonchi
6	213674	213886	+	NZ_CP016337.1	Kosakonia sacchari
7	1298515	1298676	+	NC_016845.1	Klebsiella pneumoniae subsp. pneumoniae HS11286
8	1705594	1705806	+	NZ_LR134475.1	Klebsiella aerogenes
9	2123921	2124076	+	NZ_CP045205.1	Citrobacter telavivensis

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_LR134340.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF04492.15	0.86	6	812.0	same-strand	Bacteriophage replication protein O
2	PF06992.13	0.71	5	114.0	same-strand	Replication protein P