Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein RclB (Reactive chlorine resistance protein B) |
NCBI Accession ID | U00096.3 |
Organism | Escherichia coli (strain K12) |
Left | 318331 |
Right | 318567 |
Strand | - |
Nucleotide Sequence | ATGTTTAAAAAATCTGTTTTATTTGCAACACTATTATCTGGCGTTATGGCATTTTCCACCAATGCAGATGATAAAATAATTCTGAAACATATCAGCGTCTCGTCAGTATCAGCATCACCGACAGTTCTGGAGGATACCATTGCTGATATAGCCAGAAAATATAATGCTTCATCCTGGAAAGTCACATCGATGCGAATTGATAATAATTCAACCGCAACAGCAGTATTGTATAAATAA |
Sequence | MFKKSVLFATLLSGVMAFSTNADDKIILKHISVSSVSASPTVLEDTIADIARKYNASSWKVTSMRIDNNSTATAVLYK |
Source of smORF | Swiss-Prot |
Function | Probably involved in reactive chlorine species (RCS) stress resistance. {ECO:0000269|Pubmed:24078635}. |
Pubmed ID | 9278503 16738553 24078635 |
Domain | CDD:416304 |
Functional Category | Others |
Uniprot ID | P75687 |
ORF Length (Amino Acid) | 78 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 318331 | 318567 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 361046 | 361282 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
3 | 960338 | 960574 | - | NZ_LR134340.1 | Escherichia marmotae |
4 | 357328 | 357564 | - | NZ_AP014857.1 | Escherichia albertii |
5 | 621813 | 622049 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
6 | 1031410 | 1031640 | - | NZ_CP044098.1 | Citrobacter portucalensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF12833.9 | 1.0 | 5 | 1663.0 | opposite-strand | Helix-turn-helix domain |
2 | PF00165.25 | 0.8 | 4 | 1660 | opposite-strand | Bacterial regulatory helix-turn-helix proteins, AraC family |
3 | PF04224.14 | 1.0 | 5 | 12.0 | same-strand | Protein of unknown function, DUF417 |
4 | PF07992.16 | 1.0 | 5 | 112.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
5 | PF02852.24 | 1.0 | 5 | 112.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain |
6 | PF00070.29 | 1.0 | 5 | 112.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
7 | PF12852.9 | 1.0 | 5 | 1663.0 | opposite-strand | Cupin |
8 | PF02754.18 | 0.6 | 3 | 3890.0 | opposite-strand | Cysteine-rich domain |