Result : P75687
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein RclB (Reactive chlorine resistance protein B) |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 318331 |
| Right | 318567 |
| Strand | - |
| Nucleotide Sequence | ATGTTTAAAAAATCTGTTTTATTTGCAACACTATTATCTGGCGTTATGGCATTTTCCACCAATGCAGATGATAAAATAATTCTGAAACATATCAGCGTCTCGTCAGTATCAGCATCACCGACAGTTCTGGAGGATACCATTGCTGATATAGCCAGAAAATATAATGCTTCATCCTGGAAAGTCACATCGATGCGAATTGATAATAATTCAACCGCAACAGCAGTATTGTATAAATAA |
| Sequence | MFKKSVLFATLLSGVMAFSTNADDKIILKHISVSSVSASPTVLEDTIADIARKYNASSWKVTSMRIDNNSTATAVLYK |
| Source of smORF | Swiss-Prot |
| Function | Probably involved in reactive chlorine species (RCS) stress resistance. {ECO:0000269|Pubmed:24078635}. |
| Pubmed ID | 9278503 16738553 24078635 |
| Domain | CDD:416304 |
| Functional Category | Others |
| Uniprot ID | P75687 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 318331 | 318567 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 361046 | 361282 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 960338 | 960574 | - | NZ_LR134340.1 | Escherichia marmotae |
| 4 | 357328 | 357564 | - | NZ_AP014857.1 | Escherichia albertii |
| 5 | 621813 | 622049 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 6 | 1031410 | 1031640 | - | NZ_CP044098.1 | Citrobacter portucalensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12833.9 | 1.0 | 5 | 1663.0 | opposite-strand | Helix-turn-helix domain |
| 2 | PF00165.25 | 0.8 | 4 | 1660 | opposite-strand | Bacterial regulatory helix-turn-helix proteins, AraC family |
| 3 | PF04224.14 | 1.0 | 5 | 12.0 | same-strand | Protein of unknown function, DUF417 |
| 4 | PF07992.16 | 1.0 | 5 | 112.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 5 | PF02852.24 | 1.0 | 5 | 112.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain |
| 6 | PF00070.29 | 1.0 | 5 | 112.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 7 | PF12852.9 | 1.0 | 5 | 1663.0 | opposite-strand | Cupin |
| 8 | PF02754.18 | 0.6 | 3 | 3890.0 | opposite-strand | Cysteine-rich domain |
++ More..