Result : P75620
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YaaY |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 21181 |
| Right | 21399 |
| Strand | + |
| Nucleotide Sequence | ATGTGCCGGCACTCGTTACGTAGTGATGGCGCAGGATTCTACCAGCTTGCGGGGTGTGAATACAGCTTTTCCGCGATAAAAATTGCAGCAGGCGGTCAGTTTCTTCCCGTGATTTGCGCCATGGCAATGAAAAGCCACTTCTTTCTGATTTCGGTACTCAATCGCCGGTTAACCTTGACCGCTGTACAAGGTATACTCGGACGATTTTCACTGTTTTGA |
| Sequence | MCRHSLRSDGAGFYQLAGCEYSFSAIKIAAGGQFLPVICAMAMKSHFFLISVLNRRLTLTAVQGILGRFSLF |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9278503 16738553 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P75620 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3574483 | 3574701 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 21181 | 21399 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 20136 | 20354 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 3550168 | 3550386 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 5 | 25587 | 25811 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 6 | 23993 | 24211 | + | NZ_AP014857.1 | Escherichia albertii |
| 7 | 2651669 | 2651887 | + | NZ_CP053416.1 | Salmonella bongori |
| 8 | 52661 | 52864 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 9 | 27111 | 27326 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02401.20 | 0.88 | 7 | 4878.5 | same-strand | LytB protein |
| 2 | PF00254.30 | 1.0 | 8 | 4427 | same-strand | FKBP-type peptidyl-prolyl cis-trans isomerase |
| 3 | PF01252.20 | 1.0 | 8 | 3808 | same-strand | Signal peptidase (SPase) II |
| 4 | PF00133.24 | 1.0 | 8 | 992 | same-strand | tRNA synthetases class I (I, L, M and V) |
| 5 | PF08264.15 | 1.0 | 8 | 992 | same-strand | Anticodon-binding domain of tRNA ligase |
| 6 | PF06827.16 | 1.0 | 8 | 992 | same-strand | Zinc finger found in FPG and IleRS |
| 7 | PF06574.14 | 1.0 | 8 | 8 | same-strand | FAD synthetase |
| 8 | PF01687.19 | 1.0 | 8 | 8 | same-strand | Riboflavin kinase |
| 9 | PF01649.20 | 0.75 | 6 | 103 | opposite-strand | Ribosomal protein S20 |
| 10 | PF06965.14 | 0.88 | 7 | 2561 | same-strand | Na+/H+ antiporter 1 |
| 11 | PF00126.29 | 0.88 | 7 | 1596 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 12 | PF03466.22 | 0.88 | 7 | 1596 | same-strand | LysR substrate binding domain |
++ More..