Result : P75616
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YaaX |
| NCBI Accession ID | U00096.3 |
| Organism | Escherichia coli (strain K12) |
| Left | 5234 |
| Right | 5530 |
| Strand | + |
| Nucleotide Sequence | GTGAAAAAGATGCAATCTATCGTACTCGCACTTTCCCTGGTTCTGGTCGCTCCCATGGCAGCACAGGCTGCGGAAATTACGTTAGTCCCGTCAGTAAAATTACAGATAGGCGATCGTGATAATCGTGGCTATTACTGGGATGGAGGTCACTGGCGCGACCACGGCTGGTGGAAACAACATTATGAATGGCGAGGCAATCGCTGGCACCTACACGGACCGCCGCCACCGCCGCGCCACCATAAGAAAGCTCCTCATGATCATCACGGCGGTCATGGTCCAGGCAAACATCACCGCTAA |
| Sequence | MKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYYWDGGHWRDHGWWKQHYEWRGNRWHLHGPPPPPRHHKKAPHDHHGGHGPGKHHR |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 1630901 9278503 16738553 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P75616 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5234 | 5530 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 5233 | 5529 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 3537992 | 3538291 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 4 | 4900545 | 4900832 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 5 | 3151768 | 3152058 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 6 | 680112 | 680393 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 7 | 4102290 | 4102586 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 8 | 3208162 | 3208455 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 9 | 632287 | 632613 | + | NZ_LR134340.1 | Escherichia marmotae |
| 10 | 728101 | 728403 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 11 | 3338728 | 3339000 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP045205.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00742.21 | 1.0 | 11 | 2435 | same-strand | Homoserine dehydrogenase |
| 2 | PF00696.30 | 1.0 | 11 | 2435 | same-strand | Amino acid kinase family |
| 3 | PF03447.18 | 1.0 | 11 | 2435 | same-strand | Homoserine dehydrogenase, NAD binding domain |
| 4 | PF13840.8 | 1.0 | 11 | 2435 | same-strand | ACT domain |
| 5 | PF01842.27 | 1.0 | 11 | 2435 | same-strand | ACT domain |
| 6 | PF00288.28 | 1.0 | 11 | 1503 | same-strand | GHMP kinases N terminal domain |
| 7 | PF08544.15 | 1.0 | 11 | 1503 | same-strand | GHMP kinases C terminal |
| 8 | PF00291.27 | 1.0 | 11 | 214 | same-strand | Pyridoxal-phosphate dependent enzyme |
| 9 | PF14821.8 | 1.0 | 11 | 214 | same-strand | Threonine synthase N terminus |
| 10 | PF03883.16 | 1.0 | 11 | 42 | opposite-strand | Peroxide stress protein YaaA |
| 11 | PF01235.19 | 0.91 | 10 | 882.5 | opposite-strand | Sodium:alanine symporter family |
| 12 | PF00923.21 | 1.0 | 11 | 2669 | same-strand | Transaldolase/Fructose-6-phosphate aldolase |
| 13 | PF00994.26 | 1.0 | 11 | 3736 | same-strand | Probable molybdopterin binding domain |
| 14 | PF00588.21 | 0.82 | 9 | 5258 | same-strand | SpoU rRNA Methylase family |
| 15 | PF07690.18 | 0.64 | 7 | 4340 | same-strand | Major Facilitator Superfamily |
| 16 | PF00072.26 | 0.73 | 8 | 6586.0 | opposite-strand | Response regulator receiver domain |
| 17 | PF00486.30 | 0.73 | 8 | 6586.0 | opposite-strand | Transcriptional regulatory protein, C terminal |
++ More..