Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YaaX |
NCBI Accession ID | U00096.3 |
Organism | Escherichia coli (strain K12) |
Left | 5234 |
Right | 5530 |
Strand | + |
Nucleotide Sequence | GTGAAAAAGATGCAATCTATCGTACTCGCACTTTCCCTGGTTCTGGTCGCTCCCATGGCAGCACAGGCTGCGGAAATTACGTTAGTCCCGTCAGTAAAATTACAGATAGGCGATCGTGATAATCGTGGCTATTACTGGGATGGAGGTCACTGGCGCGACCACGGCTGGTGGAAACAACATTATGAATGGCGAGGCAATCGCTGGCACCTACACGGACCGCCGCCACCGCCGCGCCACCATAAGAAAGCTCCTCATGATCATCACGGCGGTCATGGTCCAGGCAAACATCACCGCTAA |
Sequence | MKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYYWDGGHWRDHGWWKQHYEWRGNRWHLHGPPPPPRHHKKAPHDHHGGHGPGKHHR |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 1630901 9278503 16738553 |
Domain | |
Functional Category | Others |
Uniprot ID | P75616 |
ORF Length (Amino Acid) | 98 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 5234 | 5530 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 5233 | 5529 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
3 | 3537992 | 3538291 | + | NZ_CP057657.1 | Escherichia fergusonii |
4 | 4900545 | 4900832 | - | NZ_CP045205.1 | Citrobacter telavivensis |
5 | 3151768 | 3152058 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
6 | 680112 | 680393 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
7 | 4102290 | 4102586 | + | NZ_CP023529.1 | Lelliottia amnigena |
8 | 3208162 | 3208455 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
9 | 632287 | 632613 | + | NZ_LR134340.1 | Escherichia marmotae |
10 | 728101 | 728403 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
11 | 3338728 | 3339000 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00742.21 | 1.0 | 11 | 2435 | same-strand | Homoserine dehydrogenase |
2 | PF00696.30 | 1.0 | 11 | 2435 | same-strand | Amino acid kinase family |
3 | PF03447.18 | 1.0 | 11 | 2435 | same-strand | Homoserine dehydrogenase, NAD binding domain |
4 | PF13840.8 | 1.0 | 11 | 2435 | same-strand | ACT domain |
5 | PF01842.27 | 1.0 | 11 | 2435 | same-strand | ACT domain |
6 | PF00288.28 | 1.0 | 11 | 1503 | same-strand | GHMP kinases N terminal domain |
7 | PF08544.15 | 1.0 | 11 | 1503 | same-strand | GHMP kinases C terminal |
8 | PF00291.27 | 1.0 | 11 | 214 | same-strand | Pyridoxal-phosphate dependent enzyme |
9 | PF14821.8 | 1.0 | 11 | 214 | same-strand | Threonine synthase N terminus |
10 | PF03883.16 | 1.0 | 11 | 42 | opposite-strand | Peroxide stress protein YaaA |
11 | PF01235.19 | 0.91 | 10 | 882.5 | opposite-strand | Sodium:alanine symporter family |
12 | PF00923.21 | 1.0 | 11 | 2669 | same-strand | Transaldolase/Fructose-6-phosphate aldolase |
13 | PF00994.26 | 1.0 | 11 | 3736 | same-strand | Probable molybdopterin binding domain |
14 | PF00588.21 | 0.82 | 9 | 5258 | same-strand | SpoU rRNA Methylase family |
15 | PF07690.18 | 0.64 | 7 | 4340 | same-strand | Major Facilitator Superfamily |
16 | PF00072.26 | 0.73 | 8 | 6586.0 | opposite-strand | Response regulator receiver domain |
17 | PF00486.30 | 0.73 | 8 | 6586.0 | opposite-strand | Transcriptional regulatory protein, C terminal |