Result : P75502

Protein Information

• Protein name: Uncharacterized protein MG134 homolog
• NCBI Accession ID: U00089.2
• Organism: Mycoplasma pneumoniae (strain ATCC 29342 / M129)
• Left: 325680
• Right: 325982
• Strand: +
• Nucleotide Sequence: ATGAGTTTTAAAAAGATTACCGAAATGATGCGCCAAGCTGAACGACAAAGCAAGCAAAAAGCGCTTGATTTCGAGCAAAAATTGTTTGAGTACAGCTATAAGAATGCTGCCATCAAGATTATCATTTTTGGTAATCTCACCATTAAGTCTATCACAATCGATCCCGCATTAATTGACCCAGAAGACAAGGTCACTTTAGAGGAGATGATTACAGAAGCTGTCAATGAGGCTGTGGGTGATGTTAAGGCCAAGTACGACCAGTTAATGGAAGAGGCTATGCCACAGATGCCTGGGCTTTTTTAA
• Sequence: MSFKKITEMMRQAERQSKQKALDFEQKLFEYSYKNAAIKIIIFGNLTIKSITIDPALIDPEDKVTLEEMITEAVNEAVGDVKAKYDQLMEEAMPQMPGLF
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of cl00494. Profile Description: YbaB/EbfC DNA-binding family. The function of this protein is unknown, but it has been expressed and crystallized. Its gene nearly always occurs next to recR and/or dnaX. It is restricted to Bacteria and the plant Arabidopsis. The plant form contains an additional N-terminal region that may serve as a transit peptide and shows a close relationship to the cyanobacterial member, suggesting that it is a chloroplast protein. Members of this family are found in a single copy per bacterial genome, but are broadly distributed. A member is present even in the minimal gene complement of Mycoplasm genitalium. [Unknown function, General]
• Pubmed ID: 8948633
• Domain: CDD:412410
• Functional Category: Others
• Uniprot ID: P75502
• ORF Length (Amino Acid): 100

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	324048	324350	+	NZ_CP010546.1	Mycoplasma pneumoniae FH
2	159798	160100	+	NC_000908.2	Mycoplasma genitalium G37

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NZ_CP010546.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01230.25	1.0	2	791.5	opposite-strand	HIT domain
2	PF11969.10	1.0	2	791.5	opposite-strand	Scavenger mRNA decapping enzyme C-term binding
3	PF01336.27	1.0	2	868.5	same-strand	OB-fold nucleic acid binding domain