Protein name |
Sec-independent protein translocase protein TatA |
NCBI Accession ID |
CP000686.1 |
Organism |
Roseiflexus sp. (strain RS-1) |
Left |
4472523 |
Right |
4472726 |
Strand |
+ |
Nucleotide Sequence |
ATGCCACAGCTTGGAATGGGCGAACTGCTTATCATTTTGATCATTGTCCTGTTGCTGTTTGGCGCCTCGCGCATCACCGGCGTCGCCAGTGCATTGGGAGGCAGCATCAAGGCATTCCGCAAGGCGGTTCGCGACGATGACGTTCCCGCCAGCAAGAGCGAACCGGCTGAGTCGACCGATAAAAAAGTCGAAACGAACGTCTAA |
Sequence |
MPQLGMGELLIILIIVLLLFGASRITGVASALGGSIKAFRKAVRDDDVPASKSEPAESTDKKVETNV |
Source of smORF |
Swiss-Prot |
Function |
Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
Pubmed ID |
|
Domain |
CDD:294511 |
Functional Category |
Others |
Uniprot ID |
A5UZ79
|
ORF Length (Amino Acid) |
67 |